Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser] Popgenie AspWood
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT4G13850 135 / 7e-42 ATGRP2, GR-RBP2 glycine rich protein 2, glycine-rich RNA-binding protein 2 (.1.2.3.4) AT3G23830 130 / 7e-40 AtGRP4, GR-RBP4, GRP4 glycine-rich RNA-binding protein 4 (.1.2) AT5G61030 120 / 5e-34 GR-RBP3 glycine-rich RNA-binding protein 3 (.1) AT1G74230 113 / 2e-31 GR-RBP5 glycine-rich RNA-binding protein 5 (.1) AT5G47320 101 / 1e-27 RPS19 ribosomal protein S19 (.1) AT3G08000 88 / 3e-23 RNA-binding (RRM/RBD/RNP motifs) family protein (.1) AT2G21660 79 / 2e-19 CCR2, ATGRP7, GR-RBP7 GLYCINE-RICH RNA-BINDING PROTEIN 7, "cold, circadian rhythm, and rna binding 2", GLYCINE RICH PROTEIN 7, cold, circadian rhythm, and rna binding 2 (.1.2) AT4G39260 76 / 1e-18 ATGRP8, CCR1, GR-RBP8 glycine-rich RNA-binding protein 8, GLYCINE-RICH PROTEIN 8, cold, circadian rhythm, and RNA binding 1 (.1.2.3.4) AT5G06210 74 / 1e-17 RNA binding (RRM/RBD/RNP motifs) family protein (.1) AT1G18630 73 / 4e-17 GR-RBP6 glycine-rich RNA-binding protein 6 (.1)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.001G319900 [exp] 192 / 2e-64 AT4G13850 140 / 1e-43 glycine rich protein 2, glycine-rich RNA-binding protein 2 (.1.2.3.4) Potri.001G319800 [exp] 179 / 4e-59 AT4G13850 137 / 2e-42 glycine rich protein 2, glycine-rich RNA-binding protein 2 (.1.2.3.4) Potri.015G057400 [exp] 120 / 1e-34 AT5G61030 157 / 8e-47 glycine-rich RNA-binding protein 3 (.1) Potri.012G061600 [exp] 119 / 2e-34 AT5G61030 181 / 9e-56 glycine-rich RNA-binding protein 3 (.1) Potri.014G157300 [exp] 90 / 3e-24 AT3G08000 129 / 2e-39 RNA-binding (RRM/RBD/RNP motifs) family protein (.1) Potri.004G155300 [exp] 84 / 2e-21 AT2G21660 145 / 3e-45 GLYCINE-RICH RNA-BINDING PROTEIN 7, "cold, circadian rhythm, and rna binding 2", GLYCINE RICH PROTEIN 7, cold, circadian rhythm, and rna binding 2 (.1.2) Potri.009G116400 [exp] 82 / 2e-20 AT2G21660 145 / 5e-45 GLYCINE-RICH RNA-BINDING PROTEIN 7, "cold, circadian rhythm, and rna binding 2", GLYCINE RICH PROTEIN 7, cold, circadian rhythm, and rna binding 2 (.1.2) Potri.001G236300 [exp] 77 / 3e-19 AT4G13850 88 / 1e-23 glycine rich protein 2, glycine-rich RNA-binding protein 2 (.1.2.3.4) Potri.001G207100 [exp] 75 / 2e-17 AT3G26420 175 / 7e-55 RZ-1A, RNA-binding (RRM/RBD/RNP motifs) family protein with retrovirus zinc finger-like domain (.1)
Flax homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10032591 [exp] 152 / 2e-48 AT4G13850 157 / 5e-50 glycine rich protein 2, glycine-rich RNA-binding protein 2 (.1.2.3.4) Lus10022551 [exp] 150 / 1e-47 AT4G13850 167 / 7e-54 glycine rich protein 2, glycine-rich RNA-binding protein 2 (.1.2.3.4) Lus10016639 [exp] 149 / 4e-47 AT4G13850 166 / 1e-53 glycine rich protein 2, glycine-rich RNA-binding protein 2 (.1.2.3.4) Lus10043158 [exp] 148 / 9e-47 AT4G13850 154 / 1e-48 glycine rich protein 2, glycine-rich RNA-binding protein 2 (.1.2.3.4) Lus10021154 [exp] 126 / 1e-36 AT5G61030 188 / 5e-58 glycine-rich RNA-binding protein 3 (.1) Lus10040519 [exp] 124 / 8e-34 AT5G61030 189 / 2e-53 glycine-rich RNA-binding protein 3 (.1) Lus10017852 [exp] 117 / 1e-33 AT5G61030 178 / 7e-55 glycine-rich RNA-binding protein 3 (.1) Lus10034685 [exp] 113 / 1e-31 AT5G61030 177 / 7e-54 glycine-rich RNA-binding protein 3 (.1) Lus10031534 [exp] 88 / 3e-23 AT3G08000 146 / 2e-46 RNA-binding (RRM/RBD/RNP motifs) family protein (.1) Lus10015146 [exp] 88 / 4e-23 AT3G08000 145 / 5e-46 RNA-binding (RRM/RBD/RNP motifs) family protein (.1)
PFAM info	Clan ID Clan name Pfam ID Pfam name Pfam description CL0221 [poplar] [flax] RRM PF00076 [poplar] [flax] RRM_1 RNA recognition motif. (a.k.a. RRM, RBD, or RNP domain)
Representative CDS sequence Show only first row Show all	>Potri.017G059000.1 pacid=42814584 polypeptide=Potri.017G059000.1.p locus=Potri.017G059000 ID=Potri.017G059000.1.v4.1 annot-version=v4.1 ATGGCTTTCTTTAACAAGTTTGGGAGCCTAGTCAGGCAGTCAGTTTCCCAGAATGGGCAAGTTCCAATGGCATCTATGCTGAACTCTATTCGCTGCATGT CTTCATCAAAGCTTTTCATTGGAGGGCTTGCATGGTCAACTGATGATCAATCCCTCAAGGATGCATTTTCTGGCTTTGGGGAAGTGACTGAGGCAAGAGT TATCACTGATAGAGACACTGGGAGGTCTCGTGGATTCGGGTTTGTTAGTTACGAAAGCACTGAATCTGCCAGTGAAGCATTGTCAGCAATGGATGGCCAG GAATTGGGAGGAAGAAACATTCGCGTGGGTTATGCCACCGACAAGAGACAACCACAACCTTACAATAGCAATTACGGTGGGAATCCAGATTATTGA
AA sequence Show only first row Show all	>Potri.017G059000.1 pacid=42814584 polypeptide=Potri.017G059000.1.p locus=Potri.017G059000 ID=Potri.017G059000.1.v4.1 annot-version=v4.1 MAFFNKFGSLVRQSVSQNGQVPMASMLNSIRCMSSSKLFIGGLAWSTDDQSLKDAFSGFGEVTEARVITDRDTGRSRGFGFVSYESTESASEALSAMDGQ ELGGRNIRVGYATDKRQPQPYNSNYGGNPDY

---

DESeq2's median of ratios [POPLAR]

Mapped by: StringTie Salmon Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	NWA:WT	NWB:WT	NWA:OE-ARK2	NWB:OE-ARK2	NWA:miRNA-ARK2	NWB:miRNA-ARK2	NW 0hr	WT H20	WT-NW	TUA1dEY NW	TUA1dEY+TUB15 NW	TUA1dY+TUB9 NW	Pde NW	NWA:WT GA	NWBWT GA	TW:WT	TW:WT GA	NWA:OE-ARK2 GA	NWB:OE-ARK2 GA	TW:OE-ARK2	TW:OE-ARK2 GA	NWA:miRNA-ARK2 GA	NWB:miRNA-ARK2 GA	TW:miRNA-ARK2	TW:miRNA-ARK2 GA	TW 2hr	TW 8hr	TW 24hr	TW 48hr	TW 96hr	TW 336hr	WT ACC	35S::etr1-1 H20	35S::etr1-1 ACC	LMX5::etr1-1 H20	LMX5::etr1-1 ACC	WT-TW	TUA1dEY TW	TUA1dEY+TUB15 TW	TUA1dY+TUB9 TW	Pde TW	OW:WT	OW:WT GA	OW:OE-ARK2	OW:OE-ARK2 GA	OW:miRNA-ARK2	OW:miRNA-ARK2 GA	OW 2hr	OW 8hr	OW 24hr	OW 48hr	OW 96hr	OW 336hr	Root CTR	Root LongCold	Root LongDrougt	Root LongHeat	Root LongSalt	Root ShortCold	Root ShortDrougt	Root ShortHeat	Root ShortSalt	Ptr root	Leaf CTR	Leaf LongCold	Leaf LongDrougt	Leaf LongHeat	Leaf LongSalt	Leaf ShortCold	Leaf ShortDrougt	Leaf ShortHeat	Leaf ShortSalt	Ptr leaf	Stem CTR	Stem LongCold	Stem LongDrougt	Stem LongHeat	Stem LongSalt	Stem ShortCold	Stem ShortDrougt	Stem ShortHeat	Stem ShortSalt	Ptr shoot	Ptr xylem	Ptr phloem	Ptr fiber	Ptr vessel	Ptr fiber vessel ray
AT4G13850		ATGRP2, GR-RBP2	glycine rich protein 2, glycin...		Potri.017G059000 [exp]	0	1
AT1G08580			unknown protein		Potri.019G049300 [exp]	1.41	0.8536
AT5G60390			GTP binding Elongation factor ...		Potri.010G218800 [exp]	1.73	0.8661
AT2G35605			SWIB/MDM2 domain superfamily p...		Potri.013G070600 [exp]	2.64	0.8185
AT5G39850			Ribosomal protein S4 (.1)		Potri.006G209700 [exp]	3.00	0.8470
AT3G58470			nucleic acid binding;methyltra...		Potri.016G063600 [exp]	5.91	0.8347
AT2G20490		NOP10, EDA27	EMBRYO SAC DEVELOPMENT ARREST ...		Potri.005G226300 [exp]	6.32	0.8161
AT2G35605			SWIB/MDM2 domain superfamily p...		Potri.005G078400 [exp]	6.70	0.8092
AT4G22150		PUX3	plant UBX domain-containing pr...		Potri.004G004200 [exp]	7.34	0.7812
AT5G13780			Acyl-CoA N-acyltransferases (N...		Potri.001G261800 [exp]	8.94	0.7800
AT5G44200		ATCBP20, CBP20	CAP-binding protein 20 (.1.2)		Potri.007G137400 [exp]	9.69	0.7535

Compare expression of checked genes

Potri.017G059000 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.