Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser] Popgenie AspWood
Symbol	RALFL32.1
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT4G14010 71 / 8e-17 RALFL32 ralf-like 32 (.1) AT4G15800 47 / 1e-07 RALFL33 ralf-like 33 (.1) AT1G02900 41 / 2e-05 RALF1, RALFL1, ATRALF1 RALF-LIKE 1, rapid alkalinization factor 1 (.1) AT1G28270 39 / 9e-05 RALFL4 ralf-like 4 (.1) AT2G33775 39 / 0.0001 RALFL19 ralf-like 19 (.1)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.001G321300 [exp] 135 / 1e-42 AT4G14010 60 / 1e-12 ralf-like 32 (.1) Potri.001G321500 [exp] 45 / 5e-07 AT4G14010 54 / 3e-10 ralf-like 32 (.1) Potri.008G208200 [exp] 45 / 6e-07 AT4G15800 132 / 2e-41 ralf-like 33 (.1) Potri.017G059900 [exp] 44 / 2e-06 AT4G14010 45 / 4e-07 ralf-like 32 (.1) Potri.005G025800 [exp] 44 / 2e-06 AT4G15800 138 / 1e-43 ralf-like 33 (.1) Potri.004G044900 [exp] 39 / 0.0001 AT1G28270 103 / 4e-30 ralf-like 4 (.1) Potri.014G131800 [exp] 39 / 0.0001 AT4G15800 123 / 1e-37 ralf-like 33 (.1) Potri.004G045000 [exp] 39 / 0.0002 AT1G28270 103 / 4e-30 ralf-like 4 (.1) Potri.017G059500 [exp] 37 / 0.0009 AT4G13950 96 / 2e-26 ralf-like 31 (.1)
Flax homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10008885 [exp] 57 / 3e-11 AT4G14010 82 / 2e-21 ralf-like 32 (.1) Lus10023223 [exp] 49 / 2e-08 AT4G14010 83 / 2e-21 ralf-like 32 (.1) Lus10037512 [exp] 43 / 4e-06 AT4G15800 131 / 9e-41 ralf-like 33 (.1) Lus10000502 [exp] 42 / 8e-06 AT4G15800 134 / 1e-41 ralf-like 33 (.1) Lus10020647 [exp] 38 / 0.0003 AT4G15800 119 / 5e-36 ralf-like 33 (.1)
PFAM info	Clan ID Clan name Pfam ID Pfam name Pfam description PF05498 [poplar] [flax] RALF Rapid ALkalinization Factor (RALF)
Representative CDS sequence Show only first row Show all	>Potri.017G059800.5 pacid=42814434 polypeptide=Potri.017G059800.5.p locus=Potri.017G059800 ID=Potri.017G059800.5.v4.1 annot-version=v4.1 ATGGAACCAAAGTCCTTCCAATATTTTTGTTTCCTTCTAGTGATCTTCAGCCTTATAATAGCGCAGCTCAGCGACAGGGTTTCATCGAAAACTAATGAAT GCAATGGTTCAATAGCAGAATGCAGTGAAGAGTATGAGTTCTTGATGCCATCTGATATTAGTAAAAGGTTTCTTGAAGAGAAGAGAAAGTATATATCACC TGGTGCTTTGAAGCCAAACCGACCAGTTTGTAATGGTGGTGCTAGTGGTCAGTCATACAGTAGCAGTTGTCTTCCACCTCCATCTAATCCTCCTTCTCGC GGTTGTTCCAAGTACTATCATTGTAGGTCAGATAATTGA
AA sequence Show only first row Show all	>Potri.017G059800.5 pacid=42814434 polypeptide=Potri.017G059800.5.p locus=Potri.017G059800 ID=Potri.017G059800.5.v4.1 annot-version=v4.1 MEPKSFQYFCFLLVIFSLIIAQLSDRVSSKTNECNGSIAECSEEYEFLMPSDISKRFLEEKRKYISPGALKPNRPVCNGGASGQSYSSSCLPPPSNPPSR GCSKYYHCRSDN

---

DESeq2's median of ratios [POPLAR]

Mapped by: StringTie Salmon Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	NWA:WT	NWB:WT	NWA:OE-ARK2	NWB:OE-ARK2	NWA:miRNA-ARK2	NWB:miRNA-ARK2	NW 0hr	WT H20	WT-NW	TUA1dEY NW	TUA1dEY+TUB15 NW	TUA1dY+TUB9 NW	Pde NW	NWA:WT GA	NWBWT GA	TW:WT	TW:WT GA	NWA:OE-ARK2 GA	NWB:OE-ARK2 GA	TW:OE-ARK2	TW:OE-ARK2 GA	NWA:miRNA-ARK2 GA	NWB:miRNA-ARK2 GA	TW:miRNA-ARK2	TW:miRNA-ARK2 GA	TW 2hr	TW 8hr	TW 24hr	TW 48hr	TW 96hr	TW 336hr	WT ACC	35S::etr1-1 H20	35S::etr1-1 ACC	LMX5::etr1-1 H20	LMX5::etr1-1 ACC	WT-TW	TUA1dEY TW	TUA1dEY+TUB15 TW	TUA1dY+TUB9 TW	Pde TW	OW:WT	OW:WT GA	OW:OE-ARK2	OW:OE-ARK2 GA	OW:miRNA-ARK2	OW:miRNA-ARK2 GA	OW 2hr	OW 8hr	OW 24hr	OW 48hr	OW 96hr	OW 336hr	Root CTR	Root LongCold	Root LongDrougt	Root LongHeat	Root LongSalt	Root ShortCold	Root ShortDrougt	Root ShortHeat	Root ShortSalt	Ptr root	Leaf CTR	Leaf LongCold	Leaf LongDrougt	Leaf LongHeat	Leaf LongSalt	Leaf ShortCold	Leaf ShortDrougt	Leaf ShortHeat	Leaf ShortSalt	Ptr leaf	Stem CTR	Stem LongCold	Stem LongDrougt	Stem LongHeat	Stem LongSalt	Stem ShortCold	Stem ShortDrougt	Stem ShortHeat	Stem ShortSalt	Ptr shoot	Ptr xylem	Ptr phloem	Ptr fiber	Ptr vessel	Ptr fiber vessel ray
AT4G14010		RALFL32	ralf-like 32 (.1)		Potri.017G059800 [exp]	0	1	RALFL32.1
AT5G53460		GLT1	NADH-dependent glutamate synth...		Potri.015G017500 [exp]	2.23	0.7963	GLT1.2
AT2G37040		PAL1, ATPAL1	PHE ammonia lyase 1 (.1)		Potri.008G038200 [exp]	3.60	0.8370	Pt-PAL.2,PAL2
AT3G58900			F-box/RNI-like superfamily pro...		Potri.017G119200 [exp]	4.00	0.8047
AT4G18425			Protein of unknown function (D...		Potri.011G058000 [exp]	6.00	0.8060
AT1G11190		ENDO1, BFN1	ENDONUCLEASE 1, bifunctional n...		Potri.011G044500 [exp]	6.63	0.8109	BFN1.1
AT3G22060			Receptor-like protein kinase-r...		Potri.007G120700 [exp]	9.21	0.7529
AT5G04550			Protein of unknown function (D...		Potri.010G233700 [exp]	10.39	0.7669
AT1G10460		GLP7	germin-like protein 7 (.1)		Potri.010G038200 [exp]	22.24	0.7684
AT5G23750			Remorin family protein (.1.2)		Potri.003G124400 [exp]	23.87	0.7695
AT1G08250		AtADT6, ADT6	Arabidopsis thaliana arogenate...		Potri.004G188100 [exp]	26.73	0.6934

Compare expression of checked genes

Potri.017G059800 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.