Plant FIBer expression Database

Potri.017G060400 [POPLAR]


External link
JGI Phytozome v13PopgenieAspWood                  
Symbol
Arabidopsis homologues
Locus ID BLAST score/e-value TF class Alias TAIR10 short description
AT1G12845 64 / 2e-14 unknown protein
Paralogs
Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Flax homologues

No hit found
PFAM info
Representative CDS sequence
>Potri.017G060400.2 pacid=42813685 polypeptide=Potri.017G060400.2.p locus=Potri.017G060400 ID=Potri.017G060400.2.v4.1 annot-version=v4.1
ATGGCTGTCATTACAAAGGTTTCTGTTGTTATACCAATGATCATGTTCTTCGCCAGTGTGCTTGCTCTAACCAGTGAACCTACTATTGGAGCTTCTCCAG
CTGTTTTGCCATATGTAAATGCTCCTAACATGTCTTCTTTTTTCCCTCCTCCAACTGACGAATGGGATCTGGGTCCTGCAGCTCCTCCAAGATTAGGAAA
ATTGGCACCGGTGCCAATCTCAGGTGAGTTCATAGGGAAGAGTTCCTCAAGTCCAGCAGTGTTCAACGGTCATATCACCATATTTGGTATACTACTTTGT
TTCTTGCAATATTCTTATATGAAATGA
AA sequence
>Potri.017G060400.2 pacid=42813685 polypeptide=Potri.017G060400.2.p locus=Potri.017G060400 ID=Potri.017G060400.2.v4.1 annot-version=v4.1
MAVITKVSVVIPMIMFFASVLALTSEPTIGASPAVLPYVNAPNMSSFFPPPTDEWDLGPAAPPRLGKLAPVPISGEFIGKSSSSPAVFNGHITIFGILLC
FLQYSYMK

DESeq2's median of ratios [POPLAR]

Mapped by: Order by: Show schematic diagram

Coexpressed genes

Only top 10 genes are shown Show allDownload tab-delimited text
Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.
At best At TF class At alias At description Locus MR r Symbol NWA:WTNWB:WTNWA:OE-ARK2NWB:OE-ARK2NWA:miRNA-ARK2NWB:miRNA-ARK2NW 0hrWT H20WT-NWTUA1dEY NWTUA1dEY+TUB15 NWTUA1dY+TUB9 NWPde NWNWA:WT GANWBWT GATW:WTTW:WT GANWA:OE-ARK2 GANWB:OE-ARK2 GATW:OE-ARK2TW:OE-ARK2 GANWA:miRNA-ARK2 GANWB:miRNA-ARK2 GATW:miRNA-ARK2TW:miRNA-ARK2 GATW 2hrTW 8hrTW 24hrTW 48hrTW 96hrTW 336hrWT ACC35S::etr1-1 H2035S::etr1-1 ACCLMX5::etr1-1 H20LMX5::etr1-1 ACCWT-TWTUA1dEY TWTUA1dEY+TUB15 TWTUA1dY+TUB9 TWPde TWOW:WTOW:WT GAOW:OE-ARK2OW:OE-ARK2 GAOW:miRNA-ARK2OW:miRNA-ARK2 GAOW 2hrOW 8hrOW 24hrOW 48hrOW 96hrOW 336hrRoot CTRRoot LongColdRoot LongDrougtRoot LongHeatRoot LongSaltRoot ShortColdRoot ShortDrougtRoot ShortHeatRoot ShortSaltPtr rootLeaf CTRLeaf LongColdLeaf LongDrougtLeaf LongHeatLeaf LongSaltLeaf ShortColdLeaf ShortDrougtLeaf ShortHeatLeaf ShortSaltPtr leafStem CTRStem LongColdStem LongDrougtStem LongHeatStem LongSaltStem ShortColdStem ShortDrougtStem ShortHeatStem ShortSaltPtr shootPtr xylemPtr phloemPtr fiberPtr vesselPtr fiber vessel ray
AT1G12845 unknown protein Potri.017G060400
[exp]
0 1
AT3G23805 RALFL24 ralf-like 24 (.1) Potri.001G320700
[exp]
1.00 0.8613
AT1G14890 Plant invertase/pectin methyle... Potri.008G132600
[exp]
2.82 0.8175
AT5G41050 Pollen Ole e 1 allergen and ex... Potri.001G326200
[exp]
4.24 0.8404
AT5G53880 unknown protein Potri.001G398700
[exp]
4.69 0.8429
AT3G13175 unknown protein Potri.001G366900
[exp]
9.53 0.7802
AT3G50410 DOF OBP1, AtDof3. 4 OBF binding protein 1 (.1) Potri.007G036400
[exp]
11.31 0.7999 Pt-OBP1.1
AT4G33865 Ribosomal protein S14p/S29e fa... Potri.001G295902
[exp]
11.40 0.8100
AT4G39730 Lipase/lipooxygenase, PLAT/LH2... Potri.007G091100
[exp]
12.72 0.7664
AT3G51080 GATA GATA6 GATA transcription factor 6 (.... Potri.007G016600
[exp]
18.24 0.7256
AT3G05936 unknown protein Potri.005G000800
[exp]
18.33 0.7540

Potri.017G060400 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.