Potri.017G061900 [POPLAR]


External link
JGI Phytozome v13PopgenieAspWood                  
Symbol
Arabidopsis homologues
Locus ID BLAST score/e-value TF class Alias TAIR10 short description
AT5G14030 204 / 9e-67 translocon-associated protein beta (TRAPB) family protein (.1), translocon-associated protein beta (TRAPB) family protein (.2), translocon-associated protein beta (TRAPB) family protein (.3), translocon-associated protein beta (TRAPB) family protein (.4)
Paralogs
Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Potri.001G323400 251 / 2e-85 AT5G14030 215 / 2e-71 translocon-associated protein beta (TRAPB) family protein (.1), translocon-associated protein beta (TRAPB) family protein (.2), translocon-associated protein beta (TRAPB) family protein (.3), translocon-associated protein beta (TRAPB) family protein (.4)
Flax homologues
Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Lus10035166 226 / 3e-75 AT5G14030 264 / 7e-91 translocon-associated protein beta (TRAPB) family protein (.1), translocon-associated protein beta (TRAPB) family protein (.2), translocon-associated protein beta (TRAPB) family protein (.3), translocon-associated protein beta (TRAPB) family protein (.4)
Lus10031996 225 / 5e-75 AT5G14030 263 / 1e-90 translocon-associated protein beta (TRAPB) family protein (.1), translocon-associated protein beta (TRAPB) family protein (.2), translocon-associated protein beta (TRAPB) family protein (.3), translocon-associated protein beta (TRAPB) family protein (.4)
Lus10012565 217 / 9e-72 AT5G14030 254 / 5e-87 translocon-associated protein beta (TRAPB) family protein (.1), translocon-associated protein beta (TRAPB) family protein (.2), translocon-associated protein beta (TRAPB) family protein (.3), translocon-associated protein beta (TRAPB) family protein (.4)
Lus10041525 212 / 6e-68 AT5G14030 216 / 8e-70 translocon-associated protein beta (TRAPB) family protein (.1), translocon-associated protein beta (TRAPB) family protein (.2), translocon-associated protein beta (TRAPB) family protein (.3), translocon-associated protein beta (TRAPB) family protein (.4)
PFAM info
Clan ID Clan name Pfam ID Pfam name Pfam description
CL0159 E-set PF05753 TRAP_beta Translocon-associated protein beta (TRAPB)
Representative CDS sequence
>Potri.017G061900.1 pacid=42813339 polypeptide=Potri.017G061900.1.p locus=Potri.017G061900 ID=Potri.017G061900.1.v4.1 annot-version=v4.1
ATGTCGACTTCCACATTTTTCACCAAAAAACAACCAGATCCTCCTCCTGCACAACCACCACCACCACCACCACCACCACGACGAAATCCAATGGCAAACC
CGATAACAACAAAAATTCTATTCTCTATATTACTATCTCTCCTATTGGTATCCTCATCACTCGCTAGCTCCGATGTTCCCTTCATCGTCGCTCACAAGAA
AGCCACTCCCAGAGGCCTCAAATCTGGAGCTGAGCGCGTCTCCGTCTCCATCGATATTTACAATCAAGGATCCTCGACAGCATATGATATAACTCTCACT
GATGATCACTGGCCTAAAGATATATTTGATGTCGTCAGTGGCAATACTTCACAGTCATGGGACAGGCTTGATGCTGGTGGTCTCCTGTCACACGCTTTTG
AATTGGAGGGCAAAGTGAAAGGAATGTTTCACGGTTCTCCAGCAGTCATTACATTCCGTATCCCCACAAAGGCTGCCCTACAGGAGGCATATTCGACTCC
CATCCTGCCTCTTGATGTCCTTGCAGAAAAACCTCCAGTGCAGAAGTTGGAGTTGGCAAAGAAGCTTTTGGCTAAGTATGGGTCTCTAATTTCTGTGATC
TCCATTGTGGTTCTGTTCATCTACCTGCTCGTTACCCCATCCAAATCCGGTGCTGCAAAAGCAAACAAGAAGAGACGTTAA
AA sequence
>Potri.017G061900.1 pacid=42813339 polypeptide=Potri.017G061900.1.p locus=Potri.017G061900 ID=Potri.017G061900.1.v4.1 annot-version=v4.1
MSTSTFFTKKQPDPPPAQPPPPPPPPRRNPMANPITTKILFSILLSLLLVSSSLASSDVPFIVAHKKATPRGLKSGAERVSVSIDIYNQGSSTAYDITLT
DDHWPKDIFDVVSGNTSQSWDRLDAGGLLSHAFELEGKVKGMFHGSPAVITFRIPTKAALQEAYSTPILPLDVLAEKPPVQKLELAKKLLAKYGSLISVI
SIVVLFIYLLVTPSKSGAAKANKKRR

DESeq2's median of ratios [POPLAR]

Mapped by: Order by: Show schematic diagram

Coexpressed genes

Only top 10 genes are shown Show allDownload tab-delimited text
Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.
At best At TF class At alias At description Locus MR r Symbol NWA:WTNWB:WTNWA:OE-ARK2NWB:OE-ARK2NWA:miRNA-ARK2NWB:miRNA-ARK2NW 0hrWT H20WT-NWTUA1dEY NWTUA1dEY+TUB15 NWTUA1dY+TUB9 NWPde NWNWA:WT GANWBWT GATW:WTTW:WT GANWA:OE-ARK2 GANWB:OE-ARK2 GATW:OE-ARK2TW:OE-ARK2 GANWA:miRNA-ARK2 GANWB:miRNA-ARK2 GATW:miRNA-ARK2TW:miRNA-ARK2 GATW 2hrTW 8hrTW 24hrTW 48hrTW 96hrTW 336hrWT ACC35S::etr1-1 H2035S::etr1-1 ACCLMX5::etr1-1 H20LMX5::etr1-1 ACCWT-TWTUA1dEY TWTUA1dEY+TUB15 TWTUA1dY+TUB9 TWPde TWOW:WTOW:WT GAOW:OE-ARK2OW:OE-ARK2 GAOW:miRNA-ARK2OW:miRNA-ARK2 GAOW 2hrOW 8hrOW 24hrOW 48hrOW 96hrOW 336hrRoot CTRRoot LongColdRoot LongDrougtRoot LongHeatRoot LongSaltRoot ShortColdRoot ShortDrougtRoot ShortHeatRoot ShortSaltPtr rootLeaf CTRLeaf LongColdLeaf LongDrougtLeaf LongHeatLeaf LongSaltLeaf ShortColdLeaf ShortDrougtLeaf ShortHeatLeaf ShortSaltPtr leafStem CTRStem LongColdStem LongDrougtStem LongHeatStem LongSaltStem ShortColdStem ShortDrougtStem ShortHeatStem ShortSaltPtr shootPtr xylemPtr phloemPtr fiberPtr vesselPtr fiber vessel ray
AT5G14030 translocon-associated protein ... Potri.017G061900 0 1
AT1G56340 AtCRT1a, CRT1 calreticulin 1a (.1.2) Potri.005G015100 1.41 0.9433
AT3G52730 ubiquinol-cytochrome C reducta... Potri.004G188700 2.23 0.9340
AT3G07480 2Fe-2S ferredoxin-like superfa... Potri.014G177100 2.44 0.9366
AT3G25040 ERD2B endoplasmic reticulum retentio... Potri.017G056000 4.24 0.9276
AT5G14030 translocon-associated protein ... Potri.001G323400 4.47 0.9403
AT2G39960 Microsomal signal peptidase 25... Potri.010G192700 5.29 0.9316
AT1G21750 ATPDI5, ATPDIL1... ARABIDOPSIS THALIANA PROTEIN D... Potri.002G082100 5.29 0.9044 Pt-PDI.4
AT4G29480 Mitochondrial ATP synthase sub... Potri.006G232000 5.65 0.9287
AT3G22845 emp24/gp25L/p24 family/GOLD fa... Potri.010G081700 6.16 0.9122
AT3G49100 Signal recognition particle, S... Potri.002G043600 7.34 0.8906 SRP9.2

Potri.017G061900 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.