Potri.017G061950 [POPLAR]


External link
JGI Phytozome v13PopgenieAspWood                  
Symbol
Arabidopsis homologues

No hit found

Paralogs
Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Flax homologues

No hit found

PFAM info
Representative CDS sequence
>Potri.017G061950.1 pacid=42813322 polypeptide=Potri.017G061950.1.p locus=Potri.017G061950 ID=Potri.017G061950.1.v4.1 annot-version=v4.1
ATGCTAGGCCTTCTCTTCTTCCACGATATGATCAAGCCCTGCTTGATACTGACTTCAAGAACGGATCGACTAATATTTCTGATTGATGAAGAATGCAGTT
ATGCAGATGAATATTATCTGTGTTTTATAGTCTGGAATTGGGAGCACAGAGAATTAGCACACTGCATGAAAAGAGATCGTGTCATATCACTATATCTTCT
TCTCTTTCTTTTTAATTCCTACAAGCAATTAATCGAATATTTTTCAATAAATTCCTCGTTGTTAGCAGCAACCAGAAGATCAGCCTCATCTCTTTCTTTG
ATGATGATGAGTTTCACCCTTCCATATTATTTTCAGTAG
AA sequence
>Potri.017G061950.1 pacid=42813322 polypeptide=Potri.017G061950.1.p locus=Potri.017G061950 ID=Potri.017G061950.1.v4.1 annot-version=v4.1
MLGLLFFHDMIKPCLILTSRTDRLIFLIDEECSYADEYYLCFIVWNWEHRELAHCMKRDRVISLYLLLFLFNSYKQLIEYFSINSSLLAATRRSASSLSL
MMMSFTLPYYFQ

DESeq2's median of ratios [POPLAR]

Mapped by: Order by: Show schematic diagram

Coexpressed genes

Only top 10 genes are shown Show allDownload tab-delimited text
Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.
At best At TF class At alias At description Locus MR r Symbol NWA:WTNWB:WTNWA:OE-ARK2NWB:OE-ARK2NWA:miRNA-ARK2NWB:miRNA-ARK2NW 0hrWT H20WT-NWTUA1dEY NWTUA1dEY+TUB15 NWTUA1dY+TUB9 NWPde NWNWA:WT GANWBWT GATW:WTTW:WT GANWA:OE-ARK2 GANWB:OE-ARK2 GATW:OE-ARK2TW:OE-ARK2 GANWA:miRNA-ARK2 GANWB:miRNA-ARK2 GATW:miRNA-ARK2TW:miRNA-ARK2 GATW 2hrTW 8hrTW 24hrTW 48hrTW 96hrTW 336hrWT ACC35S::etr1-1 H2035S::etr1-1 ACCLMX5::etr1-1 H20LMX5::etr1-1 ACCWT-TWTUA1dEY TWTUA1dEY+TUB15 TWTUA1dY+TUB9 TWPde TWOW:WTOW:WT GAOW:OE-ARK2OW:OE-ARK2 GAOW:miRNA-ARK2OW:miRNA-ARK2 GAOW 2hrOW 8hrOW 24hrOW 48hrOW 96hrOW 336hrRoot CTRRoot LongColdRoot LongDrougtRoot LongHeatRoot LongSaltRoot ShortColdRoot ShortDrougtRoot ShortHeatRoot ShortSaltPtr rootLeaf CTRLeaf LongColdLeaf LongDrougtLeaf LongHeatLeaf LongSaltLeaf ShortColdLeaf ShortDrougtLeaf ShortHeatLeaf ShortSaltPtr leafStem CTRStem LongColdStem LongDrougtStem LongHeatStem LongSaltStem ShortColdStem ShortDrougtStem ShortHeatStem ShortSaltPtr shootPtr xylemPtr phloemPtr fiberPtr vesselPtr fiber vessel ray
Potri.017G061950 0 1
Potri.001G220400 1.73 0.8790
AT5G02070 Protein kinase family protein ... Potri.013G011700 12.96 0.8750
AT5G50400 ATPAP27, PAP27 ARABIDOPSIS THALIANA PURPLE AC... Potri.003G202200 15.09 0.8733
AT5G23660 MTN3, SWEET12, ... homolog of Medicago truncatula... Potri.015G101700 16.73 0.8713
AT2G17080 Arabidopsis protein of unknown... Potri.002G012100 18.33 0.7515
AT3G51030 ATTRX1, ATTRXH1 ARABIDOPSIS THALIANA THIOREDOX... Potri.005G232650 23.45 0.8685
AT3G12500 PR-3, PR3, CHI-... PATHOGENESIS-RELATED 3, basic ... Potri.009G142150 26.24 0.7989
AT5G03980 SGNH hydrolase-type esterase s... Potri.005G025000 27.74 0.8685
AT5G62550 unknown protein Potri.016G129250 28.72 0.8685
AT5G09520 PELPK2 Pro-Glu-Leu|Ile|Val-Pro-Lys 2,... Potri.018G146200 32.58 0.7918

Potri.017G061950 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.