Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser] Popgenie AspWood
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT5G13180 149 / 2e-44 NAC VNDIP2, ANAC083, VNI2 VND-interacting 2, NAC domain containing protein 83 (.1) AT5G14000 140 / 3e-41 NAC ANAC084 NAC domain containing protein 84 (.1) AT2G33480 131 / 5e-37 NAC ANAC041 NAC domain containing protein 41 (.1.2) AT3G15510 109 / 4e-28 NAC ATNAC2, ANAC056, NARS1 NAC-REGULATED SEED MORPHOLOGY 1, Arabidopsis NAC domain containing protein 56, NAC domain containing protein 2 (.1) AT3G04070 104 / 3e-26 NAC ANAC047 NAC domain containing protein 47 (.1.2) AT1G61110 103 / 5e-26 NAC ANAC025 NAC domain containing protein 25 (.1) AT1G77450 101 / 7e-26 NAC ANAC032 NAC domain containing protein 32 (.1) AT5G46590 101 / 2e-25 NAC ANAC096 NAC domain containing protein 96 (.1) AT5G53950 102 / 3e-25 NAC ATCUC2, CUC2, ANAC098 CUP-SHAPED COTYLEDON 2, Arabidopsis NAC domain containing protein 98, NAC (No Apical Meristem) domain transcriptional regulator superfamily protein (.1) AT4G17980 100 / 4e-25 NAC ANAC071 NAC domain containing protein 71 (.1)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.001G325100 [exp] 398 / 3e-142 AT5G13180 163 / 2e-49 VND-interacting 2, NAC domain containing protein 83 (.1) Potri.003G166500 [exp] 173 / 2e-53 AT5G13180 310 / 4e-107 VND-interacting 2, NAC domain containing protein 83 (.1) Potri.001G061200 [exp] 166 / 8e-51 AT5G13180 310 / 6e-107 VND-interacting 2, NAC domain containing protein 83 (.1) Potri.015G102100 [exp] 146 / 5e-43 AT5G13180 232 / 8e-77 VND-interacting 2, NAC domain containing protein 83 (.1) Potri.012G103500 [exp] 133 / 4e-38 AT5G13180 229 / 2e-75 VND-interacting 2, NAC domain containing protein 83 (.1) Potri.004G038000 [exp] 110 / 2e-28 AT1G61110 332 / 3e-113 NAC domain containing protein 25 (.1) Potri.011G046700 [exp] 108 / 8e-28 AT1G61110 331 / 8e-113 NAC domain containing protein 25 (.1) Potri.006G129400 [exp] 107 / 2e-27 AT1G61110 247 / 3e-80 NAC domain containing protein 25 (.1) Potri.001G404400 [exp] 107 / 5e-27 AT3G15510 345 / 1e-117 NAC-REGULATED SEED MORPHOLOGY 1, Arabidopsis NAC domain containing protein 56, NAC domain containing protein 2 (.1)
Flax homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10041534 [exp] 174 / 7e-54 AT2G33480 125 / 1e-34 NAC domain containing protein 41 (.1.2) Lus10002581 [exp] 168 / 1e-51 AT5G13180 273 / 6e-93 VND-interacting 2, NAC domain containing protein 83 (.1) Lus10001809 [exp] 162 / 2e-49 AT5G13180 271 / 6e-92 VND-interacting 2, NAC domain containing protein 83 (.1) Lus10012557 [exp] 159 / 8e-48 AT5G14000 122 / 4e-34 NAC domain containing protein 84 (.1) Lus10032004 [exp] 154 / 4e-46 AT5G14000 113 / 2e-30 NAC domain containing protein 84 (.1) Lus10035174 [exp] 144 / 3e-42 AT5G14000 115 / 2e-31 NAC domain containing protein 84 (.1) Lus10023179 [exp] 112 / 5e-29 AT1G61110 248 / 2e-80 NAC domain containing protein 25 (.1) Lus10026496 [exp] 111 / 9e-29 AT1G61110 244 / 6e-79 NAC domain containing protein 25 (.1) Lus10015076 [exp] 111 / 9e-29 AT1G61110 247 / 5e-80 NAC domain containing protein 25 (.1) Lus10036117 [exp] 109 / 5e-28 AT3G15510 241 / 2e-78 NAC-REGULATED SEED MORPHOLOGY 1, Arabidopsis NAC domain containing protein 56, NAC domain containing protein 2 (.1)
PFAM info	Clan ID Clan name Pfam ID Pfam name Pfam description PF02365 [poplar] [flax] NAM No apical meristem (NAM) protein
Representative CDS sequence Show only first row Show all	>Potri.017G063300.1 pacid=42813436 polypeptide=Potri.017G063300.1.p locus=Potri.017G063300 ID=Potri.017G063300.1.v4.1 annot-version=v4.1 ATGGAGAGGCCAAACTTTGTTGAGAATGGAGGGTTCAAATTGCCTATTGGATACAGGTTTCATCCAACGGATGAAGAGCTTGTTGTTCATTACTTGAAAC GAAAGGTCCTTGGTCTTCCAATGCCAGCTTCAGTCATTCCTGAGTTTGATGTTTTCCAAAATGATCCTTCGAGCTTGCCAGGTAATTTGAAGGAAAAGAG GTACTTCTTTAGCCAAAAGAAGTGGAATGACTTTGGAACAAAATGCAAGAGAACTGCAGGCTCTGGACCTTCTGGTTACTGGAAACCTATTGGCAAAGGC AAGCAAATCGTAGCTTCTGACAGCAACAAAGCAGTTGGAACAAGGAAAACCCTGGTTTTCAAAGAAAGAAAGCATTCTATCAAGACTAGAAGTCAATGGG TTATGCATGGATATTGCCTTGCAGGCTCGGCAACAGGCCCCAAAACGACCCAGATGGAGGAGGTGGGAGATTGGGTTGCCTACAGTGTATTTCAAAGGAA GAGGAAACCTAGAAAAAACGTGGTCATTTCCAATCCTTCAAACATTAACGAGACTCGAAATGTTGAGATCATTAGTCCTAGTTTTATGGATTTTATGATG GAACAAAGCTCTGATGGAGTTGGTCCTCCGTCACCATGTTCAAGTGGAGTCACCGAGGTCTCTTCTAACGAGGTAGATCAGGAAGAAATCAGCTCCTCCT CCATTAGCCTTTTTTCTTATCCTTGCAATAGGAAGAGGACTTAG
AA sequence Show only first row Show all	>Potri.017G063300.1 pacid=42813436 polypeptide=Potri.017G063300.1.p locus=Potri.017G063300 ID=Potri.017G063300.1.v4.1 annot-version=v4.1 MERPNFVENGGFKLPIGYRFHPTDEELVVHYLKRKVLGLPMPASVIPEFDVFQNDPSSLPGNLKEKRYFFSQKKWNDFGTKCKRTAGSGPSGYWKPIGKG KQIVASDSNKAVGTRKTLVFKERKHSIKTRSQWVMHGYCLAGSATGPKTTQMEEVGDWVAYSVFQRKRKPRKNVVISNPSNINETRNVEIISPSFMDFMM EQSSDGVGPPSPCSSGVTEVSSNEVDQEEISSSSISLFSYPCNRKRT

---

DESeq2's median of ratios [POPLAR]

Mapped by: StringTie Salmon Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	NWA:WT	NWB:WT	NWA:OE-ARK2	NWB:OE-ARK2	NWA:miRNA-ARK2	NWB:miRNA-ARK2	NW 0hr	WT H20	WT-NW	TUA1dEY NW	TUA1dEY+TUB15 NW	TUA1dY+TUB9 NW	Pde NW	NWA:WT GA	NWBWT GA	TW:WT	TW:WT GA	NWA:OE-ARK2 GA	NWB:OE-ARK2 GA	TW:OE-ARK2	TW:OE-ARK2 GA	NWA:miRNA-ARK2 GA	NWB:miRNA-ARK2 GA	TW:miRNA-ARK2	TW:miRNA-ARK2 GA	TW 2hr	TW 8hr	TW 24hr	TW 48hr	TW 96hr	TW 336hr	WT ACC	35S::etr1-1 H20	35S::etr1-1 ACC	LMX5::etr1-1 H20	LMX5::etr1-1 ACC	WT-TW	TUA1dEY TW	TUA1dEY+TUB15 TW	TUA1dY+TUB9 TW	Pde TW	OW:WT	OW:WT GA	OW:OE-ARK2	OW:OE-ARK2 GA	OW:miRNA-ARK2	OW:miRNA-ARK2 GA	OW 2hr	OW 8hr	OW 24hr	OW 48hr	OW 96hr	OW 336hr	Root CTR	Root LongCold	Root LongDrougt	Root LongHeat	Root LongSalt	Root ShortCold	Root ShortDrougt	Root ShortHeat	Root ShortSalt	Ptr root	Leaf CTR	Leaf LongCold	Leaf LongDrougt	Leaf LongHeat	Leaf LongSalt	Leaf ShortCold	Leaf ShortDrougt	Leaf ShortHeat	Leaf ShortSalt	Ptr leaf	Stem CTR	Stem LongCold	Stem LongDrougt	Stem LongHeat	Stem LongSalt	Stem ShortCold	Stem ShortDrougt	Stem ShortHeat	Stem ShortSalt	Ptr shoot	Ptr xylem	Ptr phloem	Ptr fiber	Ptr vessel	Ptr fiber vessel ray
AT5G13180	NAC	VNDIP2, ANAC083...	VND-interacting 2, NAC domain ...		Potri.017G063300 [exp]	0	1
AT1G53440			Leucine-rich repeat transmembr...		Potri.003G025566 [exp]	4.24	0.8707
AT1G53440			Leucine-rich repeat transmembr...		Potri.001G385400 [exp]	6.63	0.8691
AT2G15730			P-loop containing nucleoside t...		Potri.014G034300 [exp]	9.16	0.8576
AT3G20600		NDR1	non race-specific disease resi...		Potri.011G133900 [exp]	10.95	0.8369	Pt-NDR1.2
AT2G38470	WRKY	ATWRKY33, WRKY3...	WRKY DNA-binding protein 33 (....		Potri.006G105300 [exp]	12.96	0.8497
AT5G66320	GATA	GATA5	GATA transcription factor 5 (....		Potri.009G123400 [exp]	15.36	0.7345
AT1G16670			Protein kinase superfamily pro...		Potri.001G438400 [exp]	19.23	0.8417
AT4G37260	MYB	ATMYB73	myb domain protein 73 (.1)		Potri.014G022500 [exp]	19.62	0.8374	MYB173
AT1G35190			2-oxoglutarate (2OG) and Fe(II...		Potri.018G086900 [exp]	23.08	0.8231
AT1G34370	C2H2ZnF	STOP1	sensitive to proton rhizotoxic...		Potri.007G094100 [exp]	23.49	0.8415

Compare expression of checked genes

Potri.017G063300 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.