Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser] Popgenie AspWood
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT3G13224 215 / 2e-71 RNA-binding (RRM/RBD/RNP motifs) family protein (.1), RNA-binding (RRM/RBD/RNP motifs) family protein (.2) AT5G40490 219 / 2e-70 RNA-binding (RRM/RBD/RNP motifs) family protein (.1) AT1G17640 145 / 1e-42 RNA-binding (RRM/RBD/RNP motifs) family protein (.1) AT4G14300 131 / 7e-37 RNA-binding (RRM/RBD/RNP motifs) family protein (.1) AT4G26650 131 / 1e-36 RNA-binding (RRM/RBD/RNP motifs) family protein (.1), RNA-binding (RRM/RBD/RNP motifs) family protein (.2) AT5G55550 127 / 3e-35 RNA-binding (RRM/RBD/RNP motifs) family protein (.1), RNA-binding (RRM/RBD/RNP motifs) family protein (.2), RNA-binding (RRM/RBD/RNP motifs) family protein (.3), RNA-binding (RRM/RBD/RNP motifs) family protein (.4) AT2G33410 124 / 5e-34 RNA-binding (RRM/RBD/RNP motifs) family protein (.1) AT3G07810 124 / 9e-34 RNA-binding (RRM/RBD/RNP motifs) family protein (.1), RNA-binding (RRM/RBD/RNP motifs) family protein (.2) AT5G47620 120 / 2e-32 RNA-binding (RRM/RBD/RNP motifs) family protein (.1), RNA-binding (RRM/RBD/RNP motifs) family protein (.2), RNA-binding (RRM/RBD/RNP motifs) family protein (.3), RNA-binding (RRM/RBD/RNP motifs) family protein (.4) AT1G58470 105 / 2e-27 XF41, ATRBP1 RNA-binding protein 1 (.1)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.001G344900 [exp] 264 / 1e-88 AT5G40490 286 / 1e-93 RNA-binding (RRM/RBD/RNP motifs) family protein (.1) Potri.001G370300 [exp] 227 / 2e-74 AT3G13224 317 / 1e-106 RNA-binding (RRM/RBD/RNP motifs) family protein (.1), RNA-binding (RRM/RBD/RNP motifs) family protein (.2) Potri.001G196500 [exp] 161 / 3e-48 AT1G17640 274 / 4e-89 RNA-binding (RRM/RBD/RNP motifs) family protein (.1) Potri.003G040900 [exp] 160 / 1e-47 AT1G17640 272 / 3e-88 RNA-binding (RRM/RBD/RNP motifs) family protein (.1) Potri.014G195300 [exp] 138 / 3e-39 AT4G14300 305 / 2e-100 RNA-binding (RRM/RBD/RNP motifs) family protein (.1) Potri.002G258600 [exp] 136 / 8e-39 AT4G14300 277 / 1e-89 RNA-binding (RRM/RBD/RNP motifs) family protein (.1) Potri.010G067500 [exp] 137 / 1e-38 AT4G14300 302 / 7e-99 RNA-binding (RRM/RBD/RNP motifs) family protein (.1) Potri.008G170400 [exp] 134 / 8e-38 AT4G14300 317 / 2e-104 RNA-binding (RRM/RBD/RNP motifs) family protein (.1) Potri.002G222400 [exp] 128 / 3e-35 AT3G07810 439 / 8e-151 RNA-binding (RRM/RBD/RNP motifs) family protein (.1), RNA-binding (RRM/RBD/RNP motifs) family protein (.2)
Flax homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10032124 [exp] 232 / 1e-75 AT5G40490 307 / 3e-101 RNA-binding (RRM/RBD/RNP motifs) family protein (.1) Lus10014562 [exp] 225 / 5e-73 AT5G40490 301 / 9e-99 RNA-binding (RRM/RBD/RNP motifs) family protein (.1) Lus10032595 [exp] 210 / 7e-68 AT3G13224 357 / 2e-122 RNA-binding (RRM/RBD/RNP motifs) family protein (.1), RNA-binding (RRM/RBD/RNP motifs) family protein (.2) Lus10043154 [exp] 209 / 2e-67 AT3G13224 361 / 5e-124 RNA-binding (RRM/RBD/RNP motifs) family protein (.1), RNA-binding (RRM/RBD/RNP motifs) family protein (.2) Lus10043124 [exp] 132 / 4e-37 AT2G33410 334 / 2e-111 RNA-binding (RRM/RBD/RNP motifs) family protein (.1) Lus10032624 [exp] 129 / 5e-36 AT2G33410 335 / 2e-112 RNA-binding (RRM/RBD/RNP motifs) family protein (.1) Lus10043168 [exp] 128 / 4e-35 AT3G07810 456 / 2e-157 RNA-binding (RRM/RBD/RNP motifs) family protein (.1), RNA-binding (RRM/RBD/RNP motifs) family protein (.2) Lus10039054 [exp] 126 / 9e-35 AT3G07810 428 / 4e-147 RNA-binding (RRM/RBD/RNP motifs) family protein (.1), RNA-binding (RRM/RBD/RNP motifs) family protein (.2) Lus10000537 [exp] 127 / 1e-34 AT3G07810 420 / 8e-143 RNA-binding (RRM/RBD/RNP motifs) family protein (.1), RNA-binding (RRM/RBD/RNP motifs) family protein (.2) Lus10038806 [exp] 127 / 2e-34 AT3G07810 417 / 2e-141 RNA-binding (RRM/RBD/RNP motifs) family protein (.1), RNA-binding (RRM/RBD/RNP motifs) family protein (.2)
PFAM info	Clan ID Clan name Pfam ID Pfam name Pfam description CL0221 [poplar] [flax] RRM PF00076 [poplar] [flax] RRM_1 RNA recognition motif. (a.k.a. RRM, RBD, or RNP domain)
Representative CDS sequence Show only first row Show all	>Potri.017G064901.4 pacid=42813082 polypeptide=Potri.017G064901.4.p locus=Potri.017G064901 ID=Potri.017G064901.4.v4.1 annot-version=v4.1 ATGGACCGACACCATAACGAACCCAATCACGAGGATGAACCTAACAACGCTAAATTCACTCGACCACTCTCTGGAGATGGAGCTAGCACTGGAAAGATTT TCATTGGAGGTTTAGCAAGAGAGAGACTACTACTGGTTACACAATTCATCAAGCATTTTGGTGAATATGGTGAAATTACAGATTCTGTGATAATGAAGGA CCGGAAAACAGAGCAGCCTCGTGGATTTGGCCTTGTGACCTATTCAGATCCATCTGCTGTTGATCAAGTCATTCAAGATACTCATACTATCAATGGCAAA CAAGTTGAAATCAAGCGAACAATACCAAAGGGAGCTGTTGGGTCTAAGGATTTTAAAACCAAGAAGATATTTGTAGGTGGAATACCTGCGGTGGCGACTG AAGATGAGTTCAAGGAATTCTTTACACAATTCGGAGAGGTTACAGAACATCAGATCATGCGGGACCACTCCACCAATCGTTCTCGTGGGTTTAGATTTAT CACATTTGATACGGAGTAG
AA sequence Show only first row Show all	>Potri.017G064901.4 pacid=42813082 polypeptide=Potri.017G064901.4.p locus=Potri.017G064901 ID=Potri.017G064901.4.v4.1 annot-version=v4.1 MDRHHNEPNHEDEPNNAKFTRPLSGDGASTGKIFIGGLARERLLLVTQFIKHFGEYGEITDSVIMKDRKTEQPRGFGLVTYSDPSAVDQVIQDTHTINGK QVEIKRTIPKGAVGSKDFKTKKIFVGGIPAVATEDEFKEFFTQFGEVTEHQIMRDHSTNRSRGFRFITFDTE

---

DESeq2's median of ratios [POPLAR]

Mapped by: StringTie Salmon Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	NWA:WT	NWB:WT	NWA:OE-ARK2	NWB:OE-ARK2	NWA:miRNA-ARK2	NWB:miRNA-ARK2	NW 0hr	WT H20	WT-NW	TUA1dEY NW	TUA1dEY+TUB15 NW	TUA1dY+TUB9 NW	Pde NW	NWA:WT GA	NWBWT GA	TW:WT	TW:WT GA	NWA:OE-ARK2 GA	NWB:OE-ARK2 GA	TW:OE-ARK2	TW:OE-ARK2 GA	NWA:miRNA-ARK2 GA	NWB:miRNA-ARK2 GA	TW:miRNA-ARK2	TW:miRNA-ARK2 GA	TW 2hr	TW 8hr	TW 24hr	TW 48hr	TW 96hr	TW 336hr	WT ACC	35S::etr1-1 H20	35S::etr1-1 ACC	LMX5::etr1-1 H20	LMX5::etr1-1 ACC	WT-TW	TUA1dEY TW	TUA1dEY+TUB15 TW	TUA1dY+TUB9 TW	Pde TW	OW:WT	OW:WT GA	OW:OE-ARK2	OW:OE-ARK2 GA	OW:miRNA-ARK2	OW:miRNA-ARK2 GA	OW 2hr	OW 8hr	OW 24hr	OW 48hr	OW 96hr	OW 336hr	Root CTR	Root LongCold	Root LongDrougt	Root LongHeat	Root LongSalt	Root ShortCold	Root ShortDrougt	Root ShortHeat	Root ShortSalt	Ptr root	Leaf CTR	Leaf LongCold	Leaf LongDrougt	Leaf LongHeat	Leaf LongSalt	Leaf ShortCold	Leaf ShortDrougt	Leaf ShortHeat	Leaf ShortSalt	Ptr leaf	Stem CTR	Stem LongCold	Stem LongDrougt	Stem LongHeat	Stem LongSalt	Stem ShortCold	Stem ShortDrougt	Stem ShortHeat	Stem ShortSalt	Ptr shoot	Ptr xylem	Ptr phloem	Ptr fiber	Ptr vessel	Ptr fiber vessel ray
AT3G13224			RNA-binding (RRM/RBD/RNP motif...		Potri.017G064901 [exp]	0	1
AT1G80960			F-box and Leucine Rich Repeat ...		Potri.011G098700 [exp]	16.37	0.8149
AT1G79800		AtENODL7	early nodulin-like protein 7 (...		Potri.003G050500 [exp]	34.46	0.7694
					Potri.001G189601 [exp]	45.59	0.6907
AT1G30870			Peroxidase superfamily protein...		Potri.003G156100 [exp]	64.18	0.7095
AT5G08240			unknown protein		Potri.019G119000 [exp]	72.36	0.6828
					Potri.014G042550 [exp]	80.96	0.6342
AT2G33690			Late embryogenesis abundant pr...		Potri.002G006000 [exp]	118.79	0.6952
AT5G62490		ATHVA22B	ARABIDOPSIS THALIANA HVA22 HOM...		Potri.014G148600 [exp]	249.79	0.7076
					Potri.006G190850 [exp]	258.32	0.6715
AT1G34580			Major facilitator superfamily ...		Potri.002G096000 [exp]	282.48	0.6379	HT1.2

Compare expression of checked genes

Potri.017G064901 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.