Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser] Popgenie AspWood
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT3G01960 40 / 6e-05 unknown protein
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.001G328300 [exp] 152 / 6e-49 AT3G01960 54 / 6e-10 unknown protein Potri.015G098500 [exp] 38 / 0.0001 ND /
Flax homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10012546 [exp] 62 / 1e-13 AT3G01960 43 / 5e-06 unknown protein Lus10041547 [exp] 61 / 3e-13 ND 43 / 4e-06
PFAM info
Representative CDS sequence Show only first row Show all	>Potri.017G065916.1 pacid=42814177 polypeptide=Potri.017G065916.1.p locus=Potri.017G065916 ID=Potri.017G065916.1.v4.1 annot-version=v4.1 ATGGAGTCCAACCGCAAGCGCAGAGGGTTCATGAAGGGCAAGTTGATGCGTTTCTATCGATCATCTTCGAAGTCTTCCTCAAATGTACAGTACAGCAGCA AGGTTAAGCCAAGCCAGACTTCCCCAACAATTGCTTCAGTGGCTTACGTTGTCCACCAGGACTTTACAATTGCCCAGCAAAAGCAGAAGGTCTCATTTAC AGTGCCGGCATCAGACAACCGCCACGACAAGTTAAGCCAATTTGATAAGTTCTTTGGGGTTGTTGGTGATGTAAGAATAGATAACAAGGCTACTAGCTAC ATCTCTTCTGTTCAAGAACGTTTCAAGCTTGAATGA
AA sequence Show only first row Show all	>Potri.017G065916.1 pacid=42814177 polypeptide=Potri.017G065916.1.p locus=Potri.017G065916 ID=Potri.017G065916.1.v4.1 annot-version=v4.1 MESNRKRRGFMKGKLMRFYRSSSKSSSNVQYSSKVKPSQTSPTIASVAYVVHQDFTIAQQKQKVSFTVPASDNRHDKLSQFDKFFGVVGDVRIDNKATSY ISSVQERFKLE

---

DESeq2's median of ratios [POPLAR]

Mapped by: StringTie Salmon Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	NWA:WT	NWB:WT	NWA:OE-ARK2	NWB:OE-ARK2	NWA:miRNA-ARK2	NWB:miRNA-ARK2	NW 0hr	WT H20	WT-NW	TUA1dEY NW	TUA1dEY+TUB15 NW	TUA1dY+TUB9 NW	Pde NW	NWA:WT GA	NWBWT GA	TW:WT	TW:WT GA	NWA:OE-ARK2 GA	NWB:OE-ARK2 GA	TW:OE-ARK2	TW:OE-ARK2 GA	NWA:miRNA-ARK2 GA	NWB:miRNA-ARK2 GA	TW:miRNA-ARK2	TW:miRNA-ARK2 GA	TW 2hr	TW 8hr	TW 24hr	TW 48hr	TW 96hr	TW 336hr	WT ACC	35S::etr1-1 H20	35S::etr1-1 ACC	LMX5::etr1-1 H20	LMX5::etr1-1 ACC	WT-TW	TUA1dEY TW	TUA1dEY+TUB15 TW	TUA1dY+TUB9 TW	Pde TW	OW:WT	OW:WT GA	OW:OE-ARK2	OW:OE-ARK2 GA	OW:miRNA-ARK2	OW:miRNA-ARK2 GA	OW 2hr	OW 8hr	OW 24hr	OW 48hr	OW 96hr	OW 336hr	Root CTR	Root LongCold	Root LongDrougt	Root LongHeat	Root LongSalt	Root ShortCold	Root ShortDrougt	Root ShortHeat	Root ShortSalt	Ptr root	Leaf CTR	Leaf LongCold	Leaf LongDrougt	Leaf LongHeat	Leaf LongSalt	Leaf ShortCold	Leaf ShortDrougt	Leaf ShortHeat	Leaf ShortSalt	Ptr leaf	Stem CTR	Stem LongCold	Stem LongDrougt	Stem LongHeat	Stem LongSalt	Stem ShortCold	Stem ShortDrougt	Stem ShortHeat	Stem ShortSalt	Ptr shoot	Ptr xylem	Ptr phloem	Ptr fiber	Ptr vessel	Ptr fiber vessel ray
AT3G01960			unknown protein		Potri.017G065916 [exp]	0	1
AT1G32583			unknown protein		Potri.015G101000 [exp]	4.89	0.8109
AT2G42850		CYP718	"cytochrome P450, family 718",...		Potri.001G425675 [exp]	11.83	0.8064
AT2G42610		LSH10	LIGHT SENSITIVE HYPOCOTYLS 10,...		Potri.011G109900 [exp]	17.00	0.7495
AT3G30340			nodulin MtN21 /EamA-like trans...		Potri.011G149000 [exp]	18.00	0.8114
AT5G35090			unknown protein		Potri.018G114401 [exp]	19.44	0.7926
AT5G04980			DNAse I-like superfamily prote...		Potri.008G011000 [exp]	21.81	0.7877
AT1G19715			Mannose-binding lectin superfa...		Potri.005G232400 [exp]	23.66	0.7854
AT5G60910	MADS	FUL, AGL8	FRUITFULL, AGAMOUS-like 8 (.1....		Potri.001G328600 [exp]	24.91	0.7108
AT2G03550			alpha/beta-Hydrolases superfam...		Potri.009G105100 [exp]	25.45	0.7401
					Potri.011G165300 [exp]	26.49	0.7838

Compare expression of checked genes

Potri.017G065916 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.