Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser] Popgenie AspWood
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT5G41050 172 / 3e-55 Pollen Ole e 1 allergen and extensin family protein (.1) AT3G26960 160 / 1e-50 Pollen Ole e 1 allergen and extensin family protein (.1) AT5G13140 160 / 1e-49 Pollen Ole e 1 allergen and extensin family protein (.1) AT5G15780 47 / 2e-06 Pollen Ole e 1 allergen and extensin family protein (.1) AT5G45880 46 / 2e-06 Pollen Ole e 1 allergen and extensin family protein (.1) AT4G18596 44 / 8e-06 Pollen Ole e 1 allergen and extensin family protein (.1) AT1G78040 42 / 6e-05 Pollen Ole e 1 allergen and extensin family protein (.1.2) AT1G29140 41 / 0.0001 Pollen Ole e 1 allergen and extensin family protein (.1)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.001G326200 [exp] 284 / 1e-99 AT5G41050 158 / 9e-50 Pollen Ole e 1 allergen and extensin family protein (.1) Potri.001G060500 [exp] 195 / 8e-63 AT5G13140 185 / 3e-57 Pollen Ole e 1 allergen and extensin family protein (.1) Potri.003G167100 [exp] 174 / 1e-54 AT5G13140 180 / 2e-55 Pollen Ole e 1 allergen and extensin family protein (.1) Potri.004G114300 [exp] 67 / 2e-13 AT5G15780 178 / 5e-52 Pollen Ole e 1 allergen and extensin family protein (.1) Potri.017G100600 [exp] 64 / 2e-12 AT5G15780 173 / 1e-49 Pollen Ole e 1 allergen and extensin family protein (.1) Potri.007G090100 [exp] 42 / 3e-05 AT4G08685 152 / 1e-47 Pollen Ole e 1 allergen and extensin family protein (.1) Potri.005G078200 [exp] 40 / 0.0001 AT4G08685 165 / 5e-53 Pollen Ole e 1 allergen and extensin family protein (.1) Potri.001G392400 [exp] 40 / 0.0003 AT1G29140 137 / 1e-41 Pollen Ole e 1 allergen and extensin family protein (.1) Potri.011G111300 [exp] 39 / 0.0004 AT1G29140 148 / 4e-46 Pollen Ole e 1 allergen and extensin family protein (.1)
Flax homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10012553 [exp] 224 / 2e-76 AT5G41050 168 / 3e-54 Pollen Ole e 1 allergen and extensin family protein (.1) Lus10041541 [exp] 221 / 2e-75 AT5G41050 169 / 2e-54 Pollen Ole e 1 allergen and extensin family protein (.1) Lus10035187 [exp] 203 / 1e-67 AT5G41050 159 / 3e-50 Pollen Ole e 1 allergen and extensin family protein (.1) Lus10032018 [exp] 201 / 1e-66 AT5G41050 162 / 2e-51 Pollen Ole e 1 allergen and extensin family protein (.1) Lus10009837 [exp] 56 / 4e-10 AT5G05500 171 / 1e-54 Pollen Ole e 1 allergen and extensin family protein (.1) Lus10017440 [exp] 51 / 4e-08 AT5G05500 128 / 7e-38 Pollen Ole e 1 allergen and extensin family protein (.1) Lus10040948 [exp] 50 / 9e-08 AT5G05500 176 / 9e-57 Pollen Ole e 1 allergen and extensin family protein (.1) Lus10026040 [exp] 48 / 5e-07 AT5G10130 159 / 3e-50 Pollen Ole e 1 allergen and extensin family protein (.1) Lus10005086 [exp] 49 / 6e-07 AT5G15780 133 / 5e-35 Pollen Ole e 1 allergen and extensin family protein (.1) Lus10034365 [exp] 48 / 8e-07 AT5G15780 129 / 7e-34 Pollen Ole e 1 allergen and extensin family protein (.1)
PFAM info	Clan ID Clan name Pfam ID Pfam name Pfam description CL0287 [poplar] [flax] Transthyretin PF01190 [poplar] [flax] Pollen_Ole_e_1 Pollen protein Ole e 1 like
Representative CDS sequence Show only first row Show all	>Potri.017G068400.1 pacid=42814005 polypeptide=Potri.017G068400.1.p locus=Potri.017G068400 ID=Potri.017G068400.1.v4.1 annot-version=v4.1 ATGAATCAACTGATTATATTCTTTCTCTCATCCTTGTTTATCAACTCATTGTCTTCAAAGGCTGAACCACCTAAAAAGATTAGTGCCCATATCACTGTAA TGGGTATTGTTTATTGTGATATCTGCTCCAACAACAGTTTCTCCAGACACAGCTACTTCTTACCAGGAGCTGAAGTTAGAATGGACTGCAAGTTCGAAGC AAGCTGGCCCAAAACCAGAGAGCAGATATCATTCTCAGTGAACAGAACCACAAATAGGCACGGAATGTACAAGCTAGAAATTCCTTCTGTTGATGGAATT GCATGTGCACAAGCAGCCATTGACTCCTCCTGTGAAGCAAGCTTAATGTGGAGTTCATCTAAAGCATGCAATGTTCCTGGATACAAATCTTCAACAAAAG AGATCGCAATAAAAGTCAAACAACAAAATATCTGCATCTACAGCCTTAATGCACTGAATTTTAGACCATCAAAGACAGATGCTGGCTTATGTGGAAATTG A
AA sequence Show only first row Show all	>Potri.017G068400.1 pacid=42814005 polypeptide=Potri.017G068400.1.p locus=Potri.017G068400 ID=Potri.017G068400.1.v4.1 annot-version=v4.1 MNQLIIFFLSSLFINSLSSKAEPPKKISAHITVMGIVYCDICSNNSFSRHSYFLPGAEVRMDCKFEASWPKTREQISFSVNRTTNRHGMYKLEIPSVDGI ACAQAAIDSSCEASLMWSSSKACNVPGYKSSTKEIAIKVKQQNICIYSLNALNFRPSKTDAGLCGN

---

DESeq2's median of ratios [POPLAR]

Mapped by: StringTie Salmon Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	NWA:WT	NWB:WT	NWA:OE-ARK2	NWB:OE-ARK2	NWA:miRNA-ARK2	NWB:miRNA-ARK2	NW 0hr	WT H20	WT-NW	TUA1dEY NW	TUA1dEY+TUB15 NW	TUA1dY+TUB9 NW	Pde NW	NWA:WT GA	NWBWT GA	TW:WT	TW:WT GA	NWA:OE-ARK2 GA	NWB:OE-ARK2 GA	TW:OE-ARK2	TW:OE-ARK2 GA	NWA:miRNA-ARK2 GA	NWB:miRNA-ARK2 GA	TW:miRNA-ARK2	TW:miRNA-ARK2 GA	TW 2hr	TW 8hr	TW 24hr	TW 48hr	TW 96hr	TW 336hr	WT ACC	35S::etr1-1 H20	35S::etr1-1 ACC	LMX5::etr1-1 H20	LMX5::etr1-1 ACC	WT-TW	TUA1dEY TW	TUA1dEY+TUB15 TW	TUA1dY+TUB9 TW	Pde TW	OW:WT	OW:WT GA	OW:OE-ARK2	OW:OE-ARK2 GA	OW:miRNA-ARK2	OW:miRNA-ARK2 GA	OW 2hr	OW 8hr	OW 24hr	OW 48hr	OW 96hr	OW 336hr	Root CTR	Root LongCold	Root LongDrougt	Root LongHeat	Root LongSalt	Root ShortCold	Root ShortDrougt	Root ShortHeat	Root ShortSalt	Ptr root	Leaf CTR	Leaf LongCold	Leaf LongDrougt	Leaf LongHeat	Leaf LongSalt	Leaf ShortCold	Leaf ShortDrougt	Leaf ShortHeat	Leaf ShortSalt	Ptr leaf	Stem CTR	Stem LongCold	Stem LongDrougt	Stem LongHeat	Stem LongSalt	Stem ShortCold	Stem ShortDrougt	Stem ShortHeat	Stem ShortSalt	Ptr shoot	Ptr xylem	Ptr phloem	Ptr fiber	Ptr vessel	Ptr fiber vessel ray
AT5G41050			Pollen Ole e 1 allergen and ex...		Potri.017G068400 [exp]	0	1
AT3G54400			Eukaryotic aspartyl protease f...		Potri.001G028200 [exp]	1.00	0.9003
AT4G22130		SRF8	STRUBBELIG-receptor family 8 (...		Potri.011G010500 [exp]	1.73	0.8866
AT1G18650		PDCB3	plasmodesmata callose-binding ...		Potri.015G057800 [exp]	2.00	0.8943
AT5G05830			RING/FYVE/PHD zinc finger supe...		Potri.010G195100 [exp]	8.36	0.8110
AT1G75060			unknown protein		Potri.002G133500 [exp]	9.38	0.8015
AT4G18590			Nucleic acid-binding, OB-fold-...		Potri.010G239200 [exp]	9.59	0.8363
AT4G39900			unknown protein		Potri.007G093200 [exp]	13.41	0.7982
AT2G20515			unknown protein		Potri.002G038200 [exp]	13.63	0.8064
AT2G03870		EMB2816	EMBRYO DEFECTIVE 2816, Small n...		Potri.009G064000 [exp]	14.24	0.7718
AT5G03050			unknown protein		Potri.014G110300 [exp]	15.49	0.7497

Compare expression of checked genes

Potri.017G068400 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.