Potri.017G069350 [POPLAR]


External link
JGI Phytozome v13PopgenieAspWood                  
Symbol
Arabidopsis homologues

No hit found

Paralogs
Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Potri.003G008700 91 / 1e-21 AT1G78560 238 / 2e-74 Sodium Bile acid symporter family (.1)
Potri.001G032100 44 / 2e-05 AT3G28050 224 / 3e-70 nodulin MtN21 /EamA-like transporter family protein (.1)
Flax homologues
Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Lus10036583 66 / 8e-13 AT2G26900 229 / 4e-71 bile acid:sodium symporter family protein 2, Sodium Bile acid symporter family (.1)
Lus10035803 62 / 1e-11 AT1G78560 224 / 5e-69 Sodium Bile acid symporter family (.1)
PFAM info
Representative CDS sequence
>Potri.017G069350.2 pacid=42813451 polypeptide=Potri.017G069350.2.p locus=Potri.017G069350 ID=Potri.017G069350.2.v4.1 annot-version=v4.1
ATGAAGAAAAGGGAAATTGTGGCTTTGCCTCATCCTCTCAAAAAGCCCCTTTTCTGCAAAATAGAAGCAATGATTAATCAAATTAACAATGTCTTTAATT
TCTTTTTTACATTAAAAAAAATTAATATAACCTGTAACGCAGCAATTTTTACATTAAATAAGAACAATGGCAGTGTGTGTGACTCGGTCCCAGAATCTAA
ACTCATCACCATGTCCCTTTCTCTCCTTCTCACATCTACACGGCCCCCCCTTCTTGATCACTCACAAAAACCCCAAAAAAACTCACCTTTTCTCCACATC
CAAATCTCAGAAATTAACCTGCCCACATTGACACTGAGCTCTGGCTCTGGCTCTGGCTCTCTCCATGAGGAATCTGGTCACTTCCCTTTGTCTCCACCAA
AACCCACCTCCCTGCATGTATTGGTATCTTCTGCAGCAAGTTTTTATCCTCTCTATGTGACGGCTGGTGGGATTCTTGCTTGCTTCAACCCGTCTGCTTT
TTCTTGGTTTGTGAAGAGAGGTCCAGCTTCTTATAGTTAG
AA sequence
>Potri.017G069350.2 pacid=42813451 polypeptide=Potri.017G069350.2.p locus=Potri.017G069350 ID=Potri.017G069350.2.v4.1 annot-version=v4.1
MKKREIVALPHPLKKPLFCKIEAMINQINNVFNFFFTLKKINITCNAAIFTLNKNNGSVCDSVPESKLITMSLSLLLTSTRPPLLDHSQKPQKNSPFLHI
QISEINLPTLTLSSGSGSGSLHEESGHFPLSPPKPTSLHVLVSSAASFYPLYVTAGGILACFNPSAFSWFVKRGPASYS

DESeq2's median of ratios [POPLAR]

Mapped by: Order by: Show schematic diagram

Coexpressed genes

Only top 10 genes are shown Show allDownload tab-delimited text
Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.
At best At TF class At alias At description Locus MR r Symbol NWA:WTNWB:WTNWA:OE-ARK2NWB:OE-ARK2NWA:miRNA-ARK2NWB:miRNA-ARK2NW 0hrWT H20WT-NWTUA1dEY NWTUA1dEY+TUB15 NWTUA1dY+TUB9 NWPde NWNWA:WT GANWBWT GATW:WTTW:WT GANWA:OE-ARK2 GANWB:OE-ARK2 GATW:OE-ARK2TW:OE-ARK2 GANWA:miRNA-ARK2 GANWB:miRNA-ARK2 GATW:miRNA-ARK2TW:miRNA-ARK2 GATW 2hrTW 8hrTW 24hrTW 48hrTW 96hrTW 336hrWT ACC35S::etr1-1 H2035S::etr1-1 ACCLMX5::etr1-1 H20LMX5::etr1-1 ACCWT-TWTUA1dEY TWTUA1dEY+TUB15 TWTUA1dY+TUB9 TWPde TWOW:WTOW:WT GAOW:OE-ARK2OW:OE-ARK2 GAOW:miRNA-ARK2OW:miRNA-ARK2 GAOW 2hrOW 8hrOW 24hrOW 48hrOW 96hrOW 336hrRoot CTRRoot LongColdRoot LongDrougtRoot LongHeatRoot LongSaltRoot ShortColdRoot ShortDrougtRoot ShortHeatRoot ShortSaltPtr rootLeaf CTRLeaf LongColdLeaf LongDrougtLeaf LongHeatLeaf LongSaltLeaf ShortColdLeaf ShortDrougtLeaf ShortHeatLeaf ShortSaltPtr leafStem CTRStem LongColdStem LongDrougtStem LongHeatStem LongSaltStem ShortColdStem ShortDrougtStem ShortHeatStem ShortSaltPtr shootPtr xylemPtr phloemPtr fiberPtr vesselPtr fiber vessel ray
Potri.017G069350 0 1
Potri.010G000901 2.23 0.6756
AT1G28510 Optic atrophy 3 protein (OPA3)... Potri.019G092900 5.74 0.5713
AT4G24040 TREHALASE1, ATT... trehalase 1 (.1) Potri.006G068300 10.58 0.6383
AT1G01280 CYP703A2 "cytochrome P450, family 703, ... Potri.014G099600 26.92 0.5284
Potri.004G073950 27.23 0.4932
AT1G64160 Disease resistance-responsive ... Potri.001G096440 34.49 0.5239
AT2G36570 Leucine-rich repeat protein ki... Potri.003G020600 41.41 0.4974
AT3G12600 ATNUDT16 nudix hydrolase homolog 16 (.1... Potri.016G036700 49.77 0.5645
AT2G27500 Glycosyl hydrolase superfamily... Potri.004G097400 51.39 0.5474
Potri.015G014150 54.77 0.4786

Potri.017G069350 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.