Potri.017G071800 [POPLAR]


External link
JGI Phytozome v13PopgenieAspWood                  
Symbol
Arabidopsis homologues
Locus ID BLAST score/e-value TF class Alias TAIR10 short description
AT3G01570 130 / 6e-39 Oleosin family protein (.1)
AT3G27660 118 / 4e-34 OLE3, OLEO4 OLEOSIN 3, oleosin 4 (.1)
AT5G40420 118 / 4e-34 OLE2, PA23, OLEO2 oleosin 2 (.1)
AT4G25140 55 / 6e-10 OLE1, OLEO1 oleosin 1 (.1)
AT2G25890 54 / 2e-09 Oleosin family protein (.1)
AT5G51210 50 / 3e-08 OLEO3 oleosin3 (.1)
AT5G07550 47 / 2e-07 ATGRP19, GRP19 glycine-rich protein 19 (.1.2.3)
AT5G61610 46 / 3e-06 Oleosin family protein (.1)
AT5G07571 42 / 3e-05 Oleosin family protein (.1)
AT5G07560 40 / 0.0002 ATGRP20, GRP20 glycine-rich protein 20 (.1)
Paralogs
Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Potri.001G345800 211 / 2e-71 AT3G01570 140 / 6e-43 Oleosin family protein (.1)
Potri.015G081901 109 / 6e-31 AT5G40420 108 / 5e-30 oleosin 2 (.1)
Potri.T125308 109 / 6e-31 AT5G40420 108 / 5e-30 oleosin 2 (.1)
Potri.012G083400 105 / 1e-29 AT5G40420 97 / 2e-25 oleosin 2 (.1)
Potri.003G150600 58 / 2e-11 AT4G25140 124 / 3e-37 oleosin 1 (.1)
Potri.001G080000 54 / 6e-10 AT4G25140 108 / 1e-30 oleosin 1 (.1)
Potri.006G234900 54 / 1e-09 AT2G25890 113 / 1e-32 Oleosin family protein (.1)
Potri.018G057800 44 / 3e-06 AT2G25890 91 / 5e-24 Oleosin family protein (.1)
Potri.012G059400 40 / 0.0001 AT3G18570 113 / 4e-32 Oleosin family protein (.1)
Flax homologues
Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Lus10032127 144 / 3e-44 AT3G01570 162 / 4e-51 Oleosin family protein (.1)
Lus10014559 142 / 7e-44 AT3G01570 159 / 1e-49 Oleosin family protein (.1)
Lus10003742 89 / 4e-23 AT3G01570 142 / 1e-43 Oleosin family protein (.1)
Lus10028035 90 / 8e-23 AT3G01570 139 / 8e-42 Oleosin family protein (.1)
Lus10027161 67 / 2e-14 AT4G25140 154 / 3e-48 oleosin 1 (.1)
Lus10031387 66 / 2e-14 AT4G25140 164 / 1e-52 oleosin 1 (.1)
Lus10039683 66 / 4e-14 AT4G25140 159 / 2e-50 oleosin 1 (.1)
Lus10017460 65 / 1e-13 AT4G25140 136 / 9e-42 oleosin 1 (.1)
Lus10028822 63 / 3e-13 AT4G25140 146 / 3e-46 oleosin 1 (.1)
Lus10010943 65 / 1e-12 AT1G22400 535 / 0.0 ARABIDOPSIS THALIANA UDP-GLUCOSYL TRANSFERASE 85A1, UDP-Glycosyltransferase superfamily protein (.1)
PFAM info
Clan ID Clan name Pfam ID Pfam name Pfam description
PF01277 Oleosin Oleosin
Representative CDS sequence
>Potri.017G071800.2 pacid=42813940 polypeptide=Potri.017G071800.2.p locus=Potri.017G071800 ID=Potri.017G071800.2.v4.1 annot-version=v4.1
ATGGCTGATCGTAAGCAGCCACACCAAGTGCAAGTGCATGGCTTGAGGGGTCAACAACAGCAAGGGCCATCAGCCTCCAAAGTCCTAGCTGTGCTCACAA
TGCTACCTGTAGGTGGTGGGCTTCTTGCACTTGCAGGTATAACCCTAGTAGGCACCCTGATCGGCCTGACTGTCACCACCCCTCTTTTTTTTCTGTTCAG
CCCCGTTCTAGTCCCAGCTGCCCTTCTTATTGGGTTTGCAGCGACCTCGTTTTTGGCTTCTGGGGCCTTAGGGCTGACAGGGTTCAGGTCGCTCTCCTGG
GTTGCTAGGTACGTCCAGGAGGCTACCCGGACCATGCCGGAGAACCTGGACCAGGCAAAGAGGTGCATGCAAGACATGGCAGGTTATGTGGGGCAGAGGG
CCAAGGAAGTGGGCCAGGAAATCCAGAGGAAGGCACATGAAGGGAAATGA
AA sequence
>Potri.017G071800.2 pacid=42813940 polypeptide=Potri.017G071800.2.p locus=Potri.017G071800 ID=Potri.017G071800.2.v4.1 annot-version=v4.1
MADRKQPHQVQVHGLRGQQQQGPSASKVLAVLTMLPVGGGLLALAGITLVGTLIGLTVTTPLFFLFSPVLVPAALLIGFAATSFLASGALGLTGFRSLSW
VARYVQEATRTMPENLDQAKRCMQDMAGYVGQRAKEVGQEIQRKAHEGK

DESeq2's median of ratios [POPLAR]

Mapped by: Order by: Show schematic diagram

Coexpressed genes

Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.
At best At TF class At alias At description Locus MR r Symbol NWA:WTNWB:WTNWA:OE-ARK2NWB:OE-ARK2NWA:miRNA-ARK2NWB:miRNA-ARK2NW 0hrWT H20WT-NWTUA1dEY NWTUA1dEY+TUB15 NWTUA1dY+TUB9 NWPde NWNWA:WT GANWBWT GATW:WTTW:WT GANWA:OE-ARK2 GANWB:OE-ARK2 GATW:OE-ARK2TW:OE-ARK2 GANWA:miRNA-ARK2 GANWB:miRNA-ARK2 GATW:miRNA-ARK2TW:miRNA-ARK2 GATW 2hrTW 8hrTW 24hrTW 48hrTW 96hrTW 336hrWT ACC35S::etr1-1 H2035S::etr1-1 ACCLMX5::etr1-1 H20LMX5::etr1-1 ACCWT-TWTUA1dEY TWTUA1dEY+TUB15 TWTUA1dY+TUB9 TWPde TWOW:WTOW:WT GAOW:OE-ARK2OW:OE-ARK2 GAOW:miRNA-ARK2OW:miRNA-ARK2 GAOW 2hrOW 8hrOW 24hrOW 48hrOW 96hrOW 336hrRoot CTRRoot LongColdRoot LongDrougtRoot LongHeatRoot LongSaltRoot ShortColdRoot ShortDrougtRoot ShortHeatRoot ShortSaltPtr rootLeaf CTRLeaf LongColdLeaf LongDrougtLeaf LongHeatLeaf LongSaltLeaf ShortColdLeaf ShortDrougtLeaf ShortHeatLeaf ShortSaltPtr leafStem CTRStem LongColdStem LongDrougtStem LongHeatStem LongSaltStem ShortColdStem ShortDrougtStem ShortHeatStem ShortSaltPtr shootPtr xylemPtr phloemPtr fiberPtr vesselPtr fiber vessel ray
AT3G01570 Oleosin family protein (.1) Potri.017G071800 0 1
AT3G10910 RING/U-box superfamily protein... Potri.016G136200 53.57 0.5495
AT1G03530 ATNAF1 nuclear assembly factor 1 (.1) Potri.019G104400 142.04 0.4939

Potri.017G071800 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.