Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser] Popgenie AspWood
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT5G40020 354 / 1e-124 Pathogenesis-related thaumatin superfamily protein (.1) AT1G18250 220 / 1e-71 ATLP-1 Pathogenesis-related thaumatin superfamily protein (.1.2) AT1G73620 220 / 2e-71 Pathogenesis-related thaumatin superfamily protein (.1) AT1G75050 211 / 3e-68 Pathogenesis-related thaumatin superfamily protein (.1) AT4G38660 213 / 8e-68 Pathogenesis-related thaumatin superfamily protein (.1.2) AT5G24620 214 / 2e-67 Pathogenesis-related thaumatin superfamily protein (.1.2) AT1G75040 205 / 5e-66 PR-5, PR5 pathogenesis-related gene 5 (.1) AT1G75030 202 / 9e-65 ATLP-3 thaumatin-like protein 3 (.1) AT2G28790 202 / 1e-64 Pathogenesis-related thaumatin superfamily protein (.1) AT5G02140 201 / 7e-64 Pathogenesis-related thaumatin superfamily protein (.1)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.015G039200 [exp] 229 / 3e-75 AT1G73620 352 / 1e-123 Pathogenesis-related thaumatin superfamily protein (.1) Potri.012G047800 [exp] 228 / 7e-75 AT1G73620 379 / 3e-134 Pathogenesis-related thaumatin superfamily protein (.1) Potri.015G000800 [exp] 222 / 6e-72 AT5G24620 351 / 4e-120 Pathogenesis-related thaumatin superfamily protein (.1.2) Potri.002G020500 [exp] 215 / 7e-69 AT1G75800 404 / 7e-142 Pathogenesis-related thaumatin superfamily protein (.1) Potri.001G221700 [exp] 211 / 3e-68 AT1G75800 273 / 1e-91 Pathogenesis-related thaumatin superfamily protein (.1) Potri.014G040700 [exp] 208 / 3e-67 AT1G75030 342 / 5e-120 thaumatin-like protein 3 (.1) Potri.009G028800 [exp] 208 / 6e-67 AT2G28790 370 / 5e-131 Pathogenesis-related thaumatin superfamily protein (.1) Potri.012G004800 [exp] 209 / 1e-66 AT5G24620 358 / 1e-122 Pathogenesis-related thaumatin superfamily protein (.1.2) Potri.005G240900 [exp] 209 / 2e-66 AT1G75800 398 / 7e-140 Pathogenesis-related thaumatin superfamily protein (.1)
Flax homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10008304 [exp] 368 / 1e-129 AT5G40020 328 / 4e-114 Pathogenesis-related thaumatin superfamily protein (.1) Lus10009058 [exp] 218 / 1e-70 AT1G73620 376 / 2e-133 Pathogenesis-related thaumatin superfamily protein (.1) Lus10003962 [exp] 214 / 3e-69 AT5G02140 387 / 4e-137 Pathogenesis-related thaumatin superfamily protein (.1) Lus10032726 [exp] 209 / 2e-67 AT1G75030 334 / 5e-117 thaumatin-like protein 3 (.1) Lus10015705 [exp] 205 / 7e-66 AT1G75030 256 / 6e-86 thaumatin-like protein 3 (.1) Lus10032914 [exp] 204 / 3e-65 AT5G24620 353 / 1e-121 Pathogenesis-related thaumatin superfamily protein (.1.2) Lus10015591 [exp] 205 / 7e-65 AT5G24620 353 / 1e-120 Pathogenesis-related thaumatin superfamily protein (.1.2) Lus10023785 [exp] 203 / 9e-65 AT5G02140 379 / 2e-133 Pathogenesis-related thaumatin superfamily protein (.1) Lus10037483 [exp] 202 / 1e-63 AT1G75030 242 / 3e-79 thaumatin-like protein 3 (.1) Lus10025055 [exp] 198 / 1e-62 AT4G38660 359 / 6e-125 Pathogenesis-related thaumatin superfamily protein (.1.2)
PFAM info	Clan ID Clan name Pfam ID Pfam name Pfam description CL0293 [poplar] [flax] CDC PF00314 [poplar] [flax] Thaumatin Thaumatin family
Representative CDS sequence Show only first row Show all	>Potri.017G075500.1 pacid=42813420 polypeptide=Potri.017G075500.1.p locus=Potri.017G075500 ID=Potri.017G075500.1.v4.1 annot-version=v4.1 ATGAAGTTGCCAAAGTGGAATACTTATGGTTTCTTTCTCTTCTTGATATGCCATTCATTGTTATCAGGGCGATCATCAGGACACCAAGTTGCATTTTATG TTCACAACAAGTGCCCCTTTGCCATATGGCCGGCGACAGCCCCCAACACAGGCCATCCAGTGATTGCCGACGGTGGATTCCATCTCACCTCGGGTGAAAC TAAACGCATCTACGCTCCATGGGATTGGAAAGGCCGAATTTGGGCTCGAACTGGCTGCAATTTCACCTCCAATGGGCAACCTGCCTGTGAAACTGGTGAT TGCGATGGGCGTCTAGCATGTAATGGTCTCATAGGCACACCTCCAGTTACACTTATGCAAATATCACTTCAAGCAGATGGAACCAAGCCAAATTTTTATG ATGTGAGCTTGGTTGATGGATATAACCTTCCTGTTTCGGTAACAACGAAGCAAATCTCATCTAAATGTACCATCGGAGGGTGCTCAAAAAATTTGAAAAA TTCGTGCCCGATGGAGCTCCAGGTCCTCAACAAAAATGGGGAAATTGTGGCGTGCAAAAGCGCTTGCTTGGCTTTCAATCTTGACTCATTCTGTTGCAGT AATGAATATGGAAGCCCTGAGAAATGCAAGCCAAGCGTGTACTCGAAGATGTTTAAAGATGCATGCCCTTATTATTATAGCTATGCTTTTGATTCGCCTG CACCGCTGGTGAACTGTGCATCCAAAGAGTATATTGTCACCTTCTGCCCTTCGTCATGGGGAGGAGACCGCTCTTCGATATAA
AA sequence Show only first row Show all	>Potri.017G075500.1 pacid=42813420 polypeptide=Potri.017G075500.1.p locus=Potri.017G075500 ID=Potri.017G075500.1.v4.1 annot-version=v4.1 MKLPKWNTYGFFLFLICHSLLSGRSSGHQVAFYVHNKCPFAIWPATAPNTGHPVIADGGFHLTSGETKRIYAPWDWKGRIWARTGCNFTSNGQPACETGD CDGRLACNGLIGTPPVTLMQISLQADGTKPNFYDVSLVDGYNLPVSVTTKQISSKCTIGGCSKNLKNSCPMELQVLNKNGEIVACKSACLAFNLDSFCCS NEYGSPEKCKPSVYSKMFKDACPYYYSYAFDSPAPLVNCASKEYIVTFCPSSWGGDRSSI

---

DESeq2's median of ratios [POPLAR]

Mapped by: StringTie Salmon Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	NWA:WT	NWB:WT	NWA:OE-ARK2	NWB:OE-ARK2	NWA:miRNA-ARK2	NWB:miRNA-ARK2	NW 0hr	WT H20	WT-NW	TUA1dEY NW	TUA1dEY+TUB15 NW	TUA1dY+TUB9 NW	Pde NW	NWA:WT GA	NWBWT GA	TW:WT	TW:WT GA	NWA:OE-ARK2 GA	NWB:OE-ARK2 GA	TW:OE-ARK2	TW:OE-ARK2 GA	NWA:miRNA-ARK2 GA	NWB:miRNA-ARK2 GA	TW:miRNA-ARK2	TW:miRNA-ARK2 GA	TW 2hr	TW 8hr	TW 24hr	TW 48hr	TW 96hr	TW 336hr	WT ACC	35S::etr1-1 H20	35S::etr1-1 ACC	LMX5::etr1-1 H20	LMX5::etr1-1 ACC	WT-TW	TUA1dEY TW	TUA1dEY+TUB15 TW	TUA1dY+TUB9 TW	Pde TW	OW:WT	OW:WT GA	OW:OE-ARK2	OW:OE-ARK2 GA	OW:miRNA-ARK2	OW:miRNA-ARK2 GA	OW 2hr	OW 8hr	OW 24hr	OW 48hr	OW 96hr	OW 336hr	Root CTR	Root LongCold	Root LongDrougt	Root LongHeat	Root LongSalt	Root ShortCold	Root ShortDrougt	Root ShortHeat	Root ShortSalt	Ptr root	Leaf CTR	Leaf LongCold	Leaf LongDrougt	Leaf LongHeat	Leaf LongSalt	Leaf ShortCold	Leaf ShortDrougt	Leaf ShortHeat	Leaf ShortSalt	Ptr leaf	Stem CTR	Stem LongCold	Stem LongDrougt	Stem LongHeat	Stem LongSalt	Stem ShortCold	Stem ShortDrougt	Stem ShortHeat	Stem ShortSalt	Ptr shoot	Ptr xylem	Ptr phloem	Ptr fiber	Ptr vessel	Ptr fiber vessel ray
AT5G40020			Pathogenesis-related thaumatin...		Potri.017G075500 [exp]	0	1
AT1G58070			unknown protein		Potri.004G222800 [exp]	1.00	0.9257
AT1G79450		ALIS5	ALA-interacting subunit 5 (.1....		Potri.001G381500 [exp]	4.00	0.8409
AT5G61750			RmlC-like cupins superfamily p...		Potri.015G109600 [exp]	4.47	0.8703
AT2G01930	BBR_BPC	BPC1, BBR/BPC1,...	basic pentacysteine1 (.1.2)		Potri.008G140200 [exp]	5.91	0.8243
AT1G20850		XCP2	xylem cysteine peptidase 2 (.1...		Potri.005G256000 [exp]	6.24	0.8503	XCP2.1
AT5G54530			Protein of unknown function, D...		Potri.011G129900 [exp]	7.74	0.8186
AT3G51820		PDE325, ATG4, G...	PIGMENT DEFECTIVE 325, UbiA pr...		Potri.016G119400 [exp]	9.53	0.7794
AT5G07800			Flavin-binding monooxygenase f...		Potri.012G067500 [exp]	11.31	0.7742
AT2G33640			DHHC-type zinc finger family p...		Potri.002G006900 [exp]	12.40	0.7846
AT5G18460			Protein of Unknown Function (D...		Potri.013G050100 [exp]	12.40	0.7771

Compare expression of checked genes

Potri.017G075500 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.