Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser] Popgenie AspWood
Symbol	PtrTrxh2
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT5G39950 168 / 1e-54 ATTRXH2, ATTRX2, ATH2 Arabidopsis thioredoxin h2, thioredoxin 2 (.1) AT1G59730 124 / 2e-37 ATH7 thioredoxin H-type 7 (.1) AT1G69880 117 / 2e-34 ATH8 thioredoxin H-type 8 (.1) AT1G45145 115 / 3e-34 LIV1, ATTRX5, ATH5 LOCUS OF INSENSITIVITY TO VICTORIN 1, thioredoxin H-type 5 (.1) AT1G19730 114 / 1e-33 ATTRX4, ATH4 thioredoxin H-type 4, Thioredoxin superfamily protein (.1) AT3G51030 105 / 3e-30 ATTRX1, ATTRXH1 ARABIDOPSIS THALIANA THIOREDOXIN H-TYPE 1, thioredoxin H-type 1 (.1) AT5G42980 103 / 3e-29 ATTRXH3, ATTRX3, ATH3 THIOREDOXIN H3, thioredoxin H-type 3, thioredoxin 3 (.1) AT3G17880 92 / 1e-22 ATHIP2, ATTDX HSC-70 INTERACTING PROTEIN, ARABIDOPSIS THALIANA HSP70-INTERACTING PROTEIN 2, tetraticopeptide domain-containing thioredoxin (.1.2) AT3G56420 87 / 1e-22 Thioredoxin superfamily protein (.1) AT1G11530 80 / 4e-20 ATCXXS1 C-terminal cysteine residue is changed to a serine 1 (.1)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.008G194100 [exp] 125 / 9e-38 AT1G59730 119 / 3e-35 thioredoxin H-type 7 (.1) Potri.002G030000 [exp] 109 / 6e-32 AT3G51030 160 / 3e-52 ARABIDOPSIS THALIANA THIOREDOXIN H-TYPE 1, thioredoxin H-type 1 (.1) Potri.005G232700 [exp] 107 / 4e-31 AT3G51030 162 / 5e-53 ARABIDOPSIS THALIANA THIOREDOXIN H-TYPE 1, thioredoxin H-type 1 (.1) Potri.007G018000 [exp] 107 / 1e-30 AT3G51030 186 / 2e-62 ARABIDOPSIS THALIANA THIOREDOXIN H-TYPE 1, thioredoxin H-type 1 (.1) Potri.015G036000 [exp] 104 / 2e-27 AT3G17880 396 / 3e-137 HSC-70 INTERACTING PROTEIN, ARABIDOPSIS THALIANA HSP70-INTERACTING PROTEIN 2, tetraticopeptide domain-containing thioredoxin (.1.2) Potri.012G045000 [exp] 102 / 5e-27 AT3G17880 379 / 4e-131 HSC-70 INTERACTING PROTEIN, ARABIDOPSIS THALIANA HSP70-INTERACTING PROTEIN 2, tetraticopeptide domain-containing thioredoxin (.1.2) Potri.006G110100 [exp] 84 / 2e-21 AT3G08710 178 / 1e-58 THIOREDOXIN TYPE H 9, thioredoxin H-type 9 (.1.2) Potri.016G138800 [exp] 84 / 3e-21 AT3G08710 208 / 1e-70 THIOREDOXIN TYPE H 9, thioredoxin H-type 9 (.1.2) Potri.004G031700 [exp] 82 / 4e-21 AT1G11530 179 / 1e-59 C-terminal cysteine residue is changed to a serine 1 (.1)
Flax homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10005258 [exp] 183 / 1e-60 AT5G39950 189 / 4e-63 Arabidopsis thioredoxin h2, thioredoxin 2 (.1) Lus10030666 [exp] 183 / 1e-60 AT5G39950 189 / 3e-63 Arabidopsis thioredoxin h2, thioredoxin 2 (.1) Lus10037227 [exp] 137 / 2e-42 AT1G59730 129 / 3e-39 thioredoxin H-type 7 (.1) Lus10037228 [exp] 137 / 4e-42 AT1G59730 128 / 6e-39 thioredoxin H-type 7 (.1) Lus10036696 [exp] 137 / 7e-42 AT1G59730 127 / 2e-38 thioredoxin H-type 7 (.1) Lus10036695 [exp] 134 / 8e-41 AT5G39950 125 / 1e-37 Arabidopsis thioredoxin h2, thioredoxin 2 (.1) Lus10037225 [exp] 119 / 2e-35 AT1G69880 115 / 8e-34 thioredoxin H-type 8 (.1) Lus10036698 [exp] 118 / 7e-35 AT1G69880 113 / 5e-33 thioredoxin H-type 8 (.1) Lus10014277 [exp] 109 / 9e-32 AT3G51030 185 / 4e-62 ARABIDOPSIS THALIANA THIOREDOXIN H-TYPE 1, thioredoxin H-type 1 (.1) Lus10041799 [exp] 103 / 2e-29 AT3G51030 182 / 8e-61 ARABIDOPSIS THALIANA THIOREDOXIN H-TYPE 1, thioredoxin H-type 1 (.1)
PFAM info	Clan ID Clan name Pfam ID Pfam name Pfam description CL0172 [poplar] [flax] Thioredoxin PF13098 [poplar] [flax] Thioredoxin_2 Thioredoxin-like domain
Representative CDS sequence Show only first row Show all	>Potri.017G076700.1 pacid=42813031 polypeptide=Potri.017G076700.1.p locus=Potri.017G076700 ID=Potri.017G076700.1.v4.1 annot-version=v4.1 ATGGGAGCCGTACTGTCTTCCATTGGATCTATACTGTCTTACTTATTTGGAGCCTCAGCCGCCGGAGAAGATTCAGCATCGGATGGTCAATCGGGTGTGA CAGCGTTCCACTCCTCAGCCCGTTGGCAGCTCCATTTTAATTCCATAAAAAACACCAACCAGCTGATGGTGATTGATTTCGCGGCATCTTGGTGTGGGCC CTGCAAGCACATGGAACCAGCAGTTCATGCCATGGCTGCCAAATTTACTGATGTTCAGTTTGCCAAGATCGATGTCGATGAATTGCCTGATGTGGCACAA GAGTTTGGGGTGCAGGCAATGCCAACATTTGTGTTGGTGAAGAAAGGGAATGAAGTGGACAGGGTAGTGGGAGCTCAGAAAGAGGAGCTTCAGAGGAAGA TTGAAAAACACAGGCCTCGTTAA
AA sequence Show only first row Show all	>Potri.017G076700.1 pacid=42813031 polypeptide=Potri.017G076700.1.p locus=Potri.017G076700 ID=Potri.017G076700.1.v4.1 annot-version=v4.1 MGAVLSSIGSILSYLFGASAAGEDSASDGQSGVTAFHSSARWQLHFNSIKNTNQLMVIDFAASWCGPCKHMEPAVHAMAAKFTDVQFAKIDVDELPDVAQ EFGVQAMPTFVLVKKGNEVDRVVGAQKEELQRKIEKHRPR

---

DESeq2's median of ratios [POPLAR]

Mapped by: StringTie Salmon Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	NWA:WT	NWB:WT	NWA:OE-ARK2	NWB:OE-ARK2	NWA:miRNA-ARK2	NWB:miRNA-ARK2	NW 0hr	WT H20	WT-NW	TUA1dEY NW	TUA1dEY+TUB15 NW	TUA1dY+TUB9 NW	Pde NW	NWA:WT GA	NWBWT GA	TW:WT	TW:WT GA	NWA:OE-ARK2 GA	NWB:OE-ARK2 GA	TW:OE-ARK2	TW:OE-ARK2 GA	NWA:miRNA-ARK2 GA	NWB:miRNA-ARK2 GA	TW:miRNA-ARK2	TW:miRNA-ARK2 GA	TW 2hr	TW 8hr	TW 24hr	TW 48hr	TW 96hr	TW 336hr	WT ACC	35S::etr1-1 H20	35S::etr1-1 ACC	LMX5::etr1-1 H20	LMX5::etr1-1 ACC	WT-TW	TUA1dEY TW	TUA1dEY+TUB15 TW	TUA1dY+TUB9 TW	Pde TW	OW:WT	OW:WT GA	OW:OE-ARK2	OW:OE-ARK2 GA	OW:miRNA-ARK2	OW:miRNA-ARK2 GA	OW 2hr	OW 8hr	OW 24hr	OW 48hr	OW 96hr	OW 336hr	Root CTR	Root LongCold	Root LongDrougt	Root LongHeat	Root LongSalt	Root ShortCold	Root ShortDrougt	Root ShortHeat	Root ShortSalt	Ptr root	Leaf CTR	Leaf LongCold	Leaf LongDrougt	Leaf LongHeat	Leaf LongSalt	Leaf ShortCold	Leaf ShortDrougt	Leaf ShortHeat	Leaf ShortSalt	Ptr leaf	Stem CTR	Stem LongCold	Stem LongDrougt	Stem LongHeat	Stem LongSalt	Stem ShortCold	Stem ShortDrougt	Stem ShortHeat	Stem ShortSalt	Ptr shoot	Ptr xylem	Ptr phloem	Ptr fiber	Ptr vessel	Ptr fiber vessel ray
AT5G39950		ATTRXH2, ATTRX2...	Arabidopsis thioredoxin h2, th...		Potri.017G076700 [exp]	0	1	PtrTrxh2
AT2G34690		ACD11	ACCELERATED CELL DEATH 11, Gly...		Potri.006G051800 [exp]	1.00	0.8803	ACD11.1
AT4G13600			Carbohydrate-binding X8 domain...		Potri.017G055700 [exp]	3.46	0.8562
AT2G34700			Pollen Ole e 1 allergen and ex...		Potri.011G053600 [exp]	5.47	0.8386
AT5G67070		RALFL34	ralf-like 34 (.1)		Potri.005G139100 [exp]	5.74	0.8508
AT1G01225			NC domain-containing protein-r...		Potri.002G174700 [exp]	6.00	0.8142
AT3G58690			Protein kinase superfamily pro...		Potri.014G143100 [exp]	7.48	0.8492
AT5G53880			unknown protein		Potri.001G398700 [exp]	10.95	0.8357
AT2G17420		NTR2, ATNTRA, N...	NADPH-DEPENDENT THIOREDOXIN RE...		Potri.011G145100 [exp]	11.22	0.8218
AT1G29980			Protein of unknown function, D...		Potri.011G087500 [exp]	14.69	0.8239
AT5G09810		ACT2/7, ACT7	actin 7 (.1)		Potri.011G148000 [exp]	19.89	0.7919	ACT6

Compare expression of checked genes

Potri.017G076700 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.