Potri.017G078000 [POPLAR]


External link
JGI Phytozome v13PopgenieAspWood                  
Symbol
Arabidopsis homologues
Locus ID BLAST score/e-value TF class Alias TAIR10 short description
AT5G62740 518 / 0 AtHIR4, ATHIR1 hypersensitive induced reaction 4, HYPERSENSITIVE-INDUCED RESPONSE PROTEIN 1, SPFH/Band 7/PHB domain-containing membrane-associated protein family (.1)
AT1G69840 507 / 0 SPFH/Band 7/PHB domain-containing membrane-associated protein family (.1.2.3.4.5.6.7)
AT3G01290 459 / 6e-165 AtHIR2 hypersensitive induced reaction 2, SPFH/Band 7/PHB domain-containing membrane-associated protein family (.1)
AT5G51570 346 / 2e-120 SPFH/Band 7/PHB domain-containing membrane-associated protein family (.1)
AT5G54100 59 / 1e-09 SPFH/Band 7/PHB domain-containing membrane-associated protein family (.1)
AT4G27585 54 / 4e-08 SPFH/Band 7/PHB domain-containing membrane-associated protein family (.1)
Paralogs
Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Potri.017G078100 507 / 0 AT5G62740 488 / 3e-176 hypersensitive induced reaction 4, HYPERSENSITIVE-INDUCED RESPONSE PROTEIN 1, SPFH/Band 7/PHB domain-containing membrane-associated protein family (.1)
Potri.012G070500 479 / 6e-173 AT5G62740 484 / 3e-175 hypersensitive induced reaction 4, HYPERSENSITIVE-INDUCED RESPONSE PROTEIN 1, SPFH/Band 7/PHB domain-containing membrane-associated protein family (.1)
Potri.015G130600 343 / 2e-119 AT5G51570 510 / 0.0 SPFH/Band 7/PHB domain-containing membrane-associated protein family (.1)
Potri.012G129000 337 / 7e-117 AT5G51570 480 / 4e-173 SPFH/Band 7/PHB domain-containing membrane-associated protein family (.1)
Potri.015G065001 287 / 3e-98 AT5G62740 312 / 4e-108 hypersensitive induced reaction 4, HYPERSENSITIVE-INDUCED RESPONSE PROTEIN 1, SPFH/Band 7/PHB domain-containing membrane-associated protein family (.1)
Potri.012G005500 62 / 1e-10 AT4G27585 463 / 3e-162 SPFH/Band 7/PHB domain-containing membrane-associated protein family (.1)
Potri.015G001900 60 / 4e-10 AT4G27585 499 / 2e-176 SPFH/Band 7/PHB domain-containing membrane-associated protein family (.1)
Potri.012G009800 56 / 9e-09 AT4G27585 382 / 3e-130 SPFH/Band 7/PHB domain-containing membrane-associated protein family (.1)
Flax homologues
Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Lus10033099 513 / 0 AT5G62740 533 / 0.0 hypersensitive induced reaction 4, HYPERSENSITIVE-INDUCED RESPONSE PROTEIN 1, SPFH/Band 7/PHB domain-containing membrane-associated protein family (.1)
Lus10036715 493 / 2e-178 AT1G69840 516 / 0.0 SPFH/Band 7/PHB domain-containing membrane-associated protein family (.1.2.3.4.5.6.7)
Lus10037213 493 / 3e-178 AT1G69840 514 / 0.0 SPFH/Band 7/PHB domain-containing membrane-associated protein family (.1.2.3.4.5.6.7)
Lus10007268 489 / 5e-177 AT5G62740 510 / 0.0 hypersensitive induced reaction 4, HYPERSENSITIVE-INDUCED RESPONSE PROTEIN 1, SPFH/Band 7/PHB domain-containing membrane-associated protein family (.1)
Lus10004268 488 / 2e-176 AT5G62740 535 / 0.0 hypersensitive induced reaction 4, HYPERSENSITIVE-INDUCED RESPONSE PROTEIN 1, SPFH/Band 7/PHB domain-containing membrane-associated protein family (.1)
Lus10015356 488 / 3e-176 AT5G62740 506 / 0.0 hypersensitive induced reaction 4, HYPERSENSITIVE-INDUCED RESPONSE PROTEIN 1, SPFH/Band 7/PHB domain-containing membrane-associated protein family (.1)
Lus10015032 329 / 1e-113 AT5G51570 532 / 0.0 SPFH/Band 7/PHB domain-containing membrane-associated protein family (.1)
Lus10038907 327 / 1e-112 AT5G51570 529 / 0.0 SPFH/Band 7/PHB domain-containing membrane-associated protein family (.1)
Lus10032909 62 / 1e-10 AT4G27585 498 / 4e-176 SPFH/Band 7/PHB domain-containing membrane-associated protein family (.1)
Lus10015597 42 / 0.0005 AT4G27585 383 / 7e-130 SPFH/Band 7/PHB domain-containing membrane-associated protein family (.1)
PFAM info
Clan ID Clan name Pfam ID Pfam name Pfam description
CL0433 SPFH PF01145 Band_7 SPFH domain / Band 7 family
Representative CDS sequence
>Potri.017G078000.7 pacid=42813875 polypeptide=Potri.017G078000.7.p locus=Potri.017G078000 ID=Potri.017G078000.7.v4.1 annot-version=v4.1
ATGGGTCAAGCATTTGGTTGCCTTCAAGTGGATCAGTCTAATGTTGCTATTAAGGAACAGTTTGGAAAGTTTGTTGATGTGCTGGAGCCTGGATGTCACT
GCTTGCCTTGGTGTTTTGGATACCAAGTGGCTGGTGGACTTTCTCTTCGCGTGCAGCAACTCGATGTTAGATGTGAAACAAAAACTAAGGATAATGTATT
TGTCACTGTTGTTGCATCTATTCAGTATCGGGCCATGGCAGAGAAAGCATCTGATGCCTTCTATAAGCTCTCCAACACCAAGGCACAAATCCAGGCCTAT
GTTTTTGATGTAATCAGGGCAAGTGTGCCAAAATTGCTTTTGGATGATACTTTTGAGCAGAAAAACGATATTGCGAAGGCTGTTGAAAACGAGCTTGAAA
AGGCCATGTCTGCCTATGGGTATGAAATTGTTCAGACACTTATTGTGGATATTGAGCCGGATATTAATGTTAAGAGAGCAATGAATGAGATAAATGCTGC
TGCTAGACTGAGGGTGGCAGCAAATGAGAAGGCAGAAGCTGAGAAAATATTGCAGATCAAGCGGGCTGAAGGAGAGGCAGAGTCCAAATACCTATCAGGG
CTTGGCATAGCTCGTCAACGTCAGGCCATTGTTGATGGACTGAGGGATAGCGTGCTTGCCTTCTCTGAGAATGTGCCTGGTACGAGTGCCAAGGATGTGA
TGGATATGGTGCTGGTGACTCAGTACTTTGATACCATGAAGGAGATTGGGGCATCCTCAAAGTCATCTTCTGTTTTCATCCCTCATGGACCTGGCGCAGT
GAGAGACATCACTTCACAGATTCGTGATGGACTTCTTCAGGGAAATTCTGCTCAGTAG
AA sequence
>Potri.017G078000.7 pacid=42813875 polypeptide=Potri.017G078000.7.p locus=Potri.017G078000 ID=Potri.017G078000.7.v4.1 annot-version=v4.1
MGQAFGCLQVDQSNVAIKEQFGKFVDVLEPGCHCLPWCFGYQVAGGLSLRVQQLDVRCETKTKDNVFVTVVASIQYRAMAEKASDAFYKLSNTKAQIQAY
VFDVIRASVPKLLLDDTFEQKNDIAKAVENELEKAMSAYGYEIVQTLIVDIEPDINVKRAMNEINAAARLRVAANEKAEAEKILQIKRAEGEAESKYLSG
LGIARQRQAIVDGLRDSVLAFSENVPGTSAKDVMDMVLVTQYFDTMKEIGASSKSSSVFIPHGPGAVRDITSQIRDGLLQGNSAQ

DESeq2's median of ratios [POPLAR]

Mapped by: Order by: Show schematic diagram

Coexpressed genes

Only top 10 genes are shown Show allDownload tab-delimited text
Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.
At best At TF class At alias At description Locus MR r Symbol NWA:WTNWB:WTNWA:OE-ARK2NWB:OE-ARK2NWA:miRNA-ARK2NWB:miRNA-ARK2NW 0hrWT H20WT-NWTUA1dEY NWTUA1dEY+TUB15 NWTUA1dY+TUB9 NWPde NWNWA:WT GANWBWT GATW:WTTW:WT GANWA:OE-ARK2 GANWB:OE-ARK2 GATW:OE-ARK2TW:OE-ARK2 GANWA:miRNA-ARK2 GANWB:miRNA-ARK2 GATW:miRNA-ARK2TW:miRNA-ARK2 GATW 2hrTW 8hrTW 24hrTW 48hrTW 96hrTW 336hrWT ACC35S::etr1-1 H2035S::etr1-1 ACCLMX5::etr1-1 H20LMX5::etr1-1 ACCWT-TWTUA1dEY TWTUA1dEY+TUB15 TWTUA1dY+TUB9 TWPde TWOW:WTOW:WT GAOW:OE-ARK2OW:OE-ARK2 GAOW:miRNA-ARK2OW:miRNA-ARK2 GAOW 2hrOW 8hrOW 24hrOW 48hrOW 96hrOW 336hrRoot CTRRoot LongColdRoot LongDrougtRoot LongHeatRoot LongSaltRoot ShortColdRoot ShortDrougtRoot ShortHeatRoot ShortSaltPtr rootLeaf CTRLeaf LongColdLeaf LongDrougtLeaf LongHeatLeaf LongSaltLeaf ShortColdLeaf ShortDrougtLeaf ShortHeatLeaf ShortSaltPtr leafStem CTRStem LongColdStem LongDrougtStem LongHeatStem LongSaltStem ShortColdStem ShortDrougtStem ShortHeatStem ShortSaltPtr shootPtr xylemPtr phloemPtr fiberPtr vesselPtr fiber vessel ray
AT5G62740 AtHIR4, ATHIR1 hypersensitive induced reactio... Potri.017G078000 0 1
AT3G57090 FIS1A, BIGYIN FISSION 1A, Tetratricopeptide ... Potri.006G041900 2.23 0.8470
AT4G04210 PUX4 plant UBX domain containing pr... Potri.006G270300 3.74 0.8689
AT4G04210 PUX4 plant UBX domain containing pr... Potri.011G011300 4.47 0.8367
AT2G43060 bHLH AtIBH1, bHLH158 ILI1 binding bHLH 1 (.1) Potri.014G149800 5.19 0.8545
AT5G42890 ATSCP2 sterol carrier protein 2 (.1) Potri.002G126200 5.74 0.8057
AT3G61200 Thioesterase superfamily prote... Potri.014G078900 11.00 0.7771
AT1G31340 NEDD8, ATRUB1, ... ARABIDOPSIS THALIANA RELATED T... Potri.005G198700 13.67 0.8329 SUBI.4
AT5G38260 Protein kinase superfamily pro... Potri.007G125600 16.06 0.8608
AT3G17000 UBC32 ubiquitin-conjugating enzyme 3... Potri.008G106300 22.91 0.7797
AT4G27130 Translation initiation factor ... Potri.007G122700 26.07 0.8034

Potri.017G078000 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.