Plant FIBer expression Database

Potri.017G079901 [POPLAR]


External link
JGI Phytozome v13PopgenieAspWood                  
Symbol
Arabidopsis homologues

No hit found

Paralogs
Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Flax homologues
Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Lus10025368
[exp]
41 / 1e-05 AT3G42860 44 / 1e-05 zinc knuckle (CCHC-type) family protein (.1)
Lus10004093
[exp]
38 / 7e-05 ND 39 / 6e-04
Lus10014888
[exp]
38 / 9e-05 ND 39 / 7e-04
PFAM info
Clan ID Clan name Pfam ID Pfam name Pfam description
CL0167 Zn_Beta_Ribbon PF06839 zf-GRF GRF zinc finger
Representative CDS sequence
>Potri.017G079901.1 pacid=42813681 polypeptide=Potri.017G079901.1.p locus=Potri.017G079901 ID=Potri.017G079901.1.v4.1 annot-version=v4.1
ATGAGCTTCGCAATTTGTCAGTCATCGATGTGGGATTACGATGATCCAGAAATAAAGTGTGGATGTAATTTGAAGACACCCAGATGGACATCATGGACAA
ATGATAGCCCAGGTATGAGGTTTCATGCTTGTCAAAAACCTAGGAGAAAAAGCTGTGGCTTCTTTAGGTTTATTGATCCTCCAGACCATACAAATTTATT
GTCGGGTTGA
AA sequence
>Potri.017G079901.1 pacid=42813681 polypeptide=Potri.017G079901.1.p locus=Potri.017G079901 ID=Potri.017G079901.1.v4.1 annot-version=v4.1
MSFAICQSSMWDYDDPEIKCGCNLKTPRWTSWTNDSPGMRFHACQKPRRKSCGFFRFIDPPDHTNLLSG

DESeq2's median of ratios [POPLAR]

Mapped by: Order by: Show schematic diagram

Coexpressed genes

Only top 10 genes are shown Show allDownload tab-delimited text
Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.
At best At TF class At alias At description Locus MR r Symbol NWA:WTNWB:WTNWA:OE-ARK2NWB:OE-ARK2NWA:miRNA-ARK2NWB:miRNA-ARK2NW 0hrWT H20WT-NWTUA1dEY NWTUA1dEY+TUB15 NWTUA1dY+TUB9 NWPde NWNWA:WT GANWBWT GATW:WTTW:WT GANWA:OE-ARK2 GANWB:OE-ARK2 GATW:OE-ARK2TW:OE-ARK2 GANWA:miRNA-ARK2 GANWB:miRNA-ARK2 GATW:miRNA-ARK2TW:miRNA-ARK2 GATW 2hrTW 8hrTW 24hrTW 48hrTW 96hrTW 336hrWT ACC35S::etr1-1 H2035S::etr1-1 ACCLMX5::etr1-1 H20LMX5::etr1-1 ACCWT-TWTUA1dEY TWTUA1dEY+TUB15 TWTUA1dY+TUB9 TWPde TWOW:WTOW:WT GAOW:OE-ARK2OW:OE-ARK2 GAOW:miRNA-ARK2OW:miRNA-ARK2 GAOW 2hrOW 8hrOW 24hrOW 48hrOW 96hrOW 336hrRoot CTRRoot LongColdRoot LongDrougtRoot LongHeatRoot LongSaltRoot ShortColdRoot ShortDrougtRoot ShortHeatRoot ShortSaltPtr rootLeaf CTRLeaf LongColdLeaf LongDrougtLeaf LongHeatLeaf LongSaltLeaf ShortColdLeaf ShortDrougtLeaf ShortHeatLeaf ShortSaltPtr leafStem CTRStem LongColdStem LongDrougtStem LongHeatStem LongSaltStem ShortColdStem ShortDrougtStem ShortHeatStem ShortSaltPtr shootPtr xylemPtr phloemPtr fiberPtr vesselPtr fiber vessel ray
Potri.017G079901
[exp]
0 1
AT1G74830 Protein of unknown function, D... Potri.012G073400
[exp]
2.00 0.9290
AT3G03740 ATBPM4 BTB-POZ and MATH domain 4 (.1) Potri.001G184200
[exp]
11.00 0.9072
AT5G63830 HIT-type Zinc finger family pr... Potri.003G145100
[exp]
12.68 0.9160
AT1G56400 F-box family protein (.1.2) Potri.011G136200
[exp]
13.41 0.9182
AT5G47430 DWNN domain, a CCHC-type zinc ... Potri.003G078800
[exp]
14.89 0.8264
AT1G09140 ATSRP30.1, ATSR... Serine/Arginine-Rich Protein S... Potri.005G024600
[exp]
15.49 0.9222
AT1G24430 HXXXD-type acyl-transferase fa... Potri.017G029300
[exp]
20.78 0.8820
AT5G42220 Ubiquitin-like superfamily pro... Potri.002G013500
[exp]
22.27 0.8920
AT1G31240 Bromodomain transcription fact... Potri.012G119500
[exp]
25.80 0.9102
AT5G64600 O-fucosyltransferase family pr... Potri.005G059600
[exp]
26.94 0.8678

Potri.017G079901 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.