Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser] Popgenie AspWood
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT3G29090 273 / 4e-92 PME31, ATPME31 A. THALIANA PECTIN METHYLESTERASE 31, pectin methylesterase 31 (.1) AT5G19730 132 / 1e-36 Pectin lyase-like superfamily protein (.1) AT1G23200 111 / 3e-28 Plant invertase/pectin methylesterase inhibitor superfamily (.1) AT3G05620 107 / 1e-26 Plant invertase/pectin methylesterase inhibitor superfamily (.1) AT1G05310 104 / 3e-26 Pectin lyase-like superfamily protein (.1) AT4G15980 106 / 4e-26 Plant invertase/pectin methylesterase inhibitor superfamily (.1) AT5G49180 101 / 1e-24 Plant invertase/pectin methylesterase inhibitor superfamily (.1) AT3G43270 101 / 1e-24 Plant invertase/pectin methylesterase inhibitor superfamily (.1) AT5G55590 99 / 3e-24 QRT1 QUARTET 1, Pectin lyase-like superfamily protein (.1) AT2G36700 98 / 4e-24 Pectin lyase-like superfamily protein (.1)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.004G128820 [exp] 288 / 5e-98 AT3G29090 562 / 0.0 A. THALIANA PECTIN METHYLESTERASE 31, pectin methylesterase 31 (.1) Potri.018G068400 [exp] 130 / 4e-36 AT5G19730 603 / 0.0 Pectin lyase-like superfamily protein (.1) Potri.007G015700 [exp] 129 / 8e-36 AT5G19730 472 / 2e-167 Pectin lyase-like superfamily protein (.1) Potri.014G117100 [exp] 114 / 5e-30 AT5G19730 320 / 3e-107 Pectin lyase-like superfamily protein (.1) Potri.006G256600 [exp] 105 / 7e-26 AT3G14310 548 / 0.0 pectin methylesterase 3 (.1) Potri.006G256700 [exp] 104 / 8e-26 AT3G14310 587 / 0.0 pectin methylesterase 3 (.1) Potri.018G051400 [exp] 104 / 1e-25 AT3G14310 708 / 0.0 pectin methylesterase 3 (.1) Potri.001G162600 [exp] 103 / 2e-25 AT3G14310 551 / 0.0 pectin methylesterase 3 (.1) Potri.001G162400 [exp] 102 / 4e-25 AT3G14310 792 / 0.0 pectin methylesterase 3 (.1)
Flax homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10014338 [exp] 259 / 1e-86 AT3G29090 545 / 0.0 A. THALIANA PECTIN METHYLESTERASE 31, pectin methylesterase 31 (.1) Lus10026047 [exp] 259 / 2e-86 AT3G29090 548 / 0.0 A. THALIANA PECTIN METHYLESTERASE 31, pectin methylesterase 31 (.1) Lus10041699 [exp] 256 / 3e-85 AT3G29090 527 / 0.0 A. THALIANA PECTIN METHYLESTERASE 31, pectin methylesterase 31 (.1) Lus10024050 [exp] 139 / 3e-41 AT3G29090 258 / 4e-87 A. THALIANA PECTIN METHYLESTERASE 31, pectin methylesterase 31 (.1) Lus10041815 [exp] 124 / 1e-33 AT5G19730 446 / 1e-156 Pectin lyase-like superfamily protein (.1) Lus10028364 [exp] 122 / 2e-33 AT5G19730 437 / 4e-154 Pectin lyase-like superfamily protein (.1) Lus10012942 [exp] 123 / 4e-33 AT5G19730 594 / 0.0 Pectin lyase-like superfamily protein (.1) Lus10043035 [exp] 119 / 6e-32 AT5G19730 555 / 0.0 Pectin lyase-like superfamily protein (.1) Lus10011132 [exp] 119 / 9e-32 AT5G19730 575 / 0.0 Pectin lyase-like superfamily protein (.1) Lus10010470 [exp] 109 / 7e-28 AT1G05310 521 / 0.0 Pectin lyase-like superfamily protein (.1)
PFAM info	Clan ID Clan name Pfam ID Pfam name Pfam description CL0268 [poplar] [flax] Pec_lyase-like PF01095 [poplar] [flax] Pectinesterase Pectinesterase
Representative CDS sequence Show only first row Show all	>Potri.017G087300.2 pacid=42813340 polypeptide=Potri.017G087300.2.p locus=Potri.017G087300 ID=Potri.017G087300.2.v4.1 annot-version=v4.1 ATGGTGCAGGAAGCAATAGATGGGGTGCCACTCCGCAACACGTGCAGAACTGTGATTCGTGTGCCACCTGGGGTTTACTGGCAACCCGTACCAGAAGTTA CTAGCTTGACTTGGAACAACACTTCTACCAAAAATGATCATCACCAGGCTTCGAGGGTCATTGAGACTGGGACCTTTAGGTGTGGGACTGTGGTTGTGGA AGGAGAGGGTTTTATTACTGAGACTATCACTTTTGAGAAATTTTCTCCTGAGGTGAATACAGTACTTGATAATTGTTTTCTTTTAGCCATTGGTTGTGTC AGAATGTATGATTCGAGGTGTTCAGGTCAAGCTGTGGCAATTAGAGTGACAGCTGATTGGTATGCATTCTATAATTGCCTGTTCATTGGGTGGCAGGATA CTCTTTATTTGCATTATGGGAAGCAGTATTTGAAAGATTGCTACATTGAAGGCTACGTGGACTTTATTTTTGGGAATATCACTGCTCTATTGGAACATTG TCATATCCAATGCAAATCAGCAGGTCTTTTAATTGCTCAAAGCATAAAATCTTCCCAGGAGTCAACTGGTTATGTCTTTCCAAGGTGGGGGACTTCATAT ATGTGCCTTGAACGTCCATGGGGACTCTTTGGAAGAATCATTGTAGCAGACATGGCCTTGAGGATACCATATTCTGCACAGAAACTATAA
AA sequence Show only first row Show all	>Potri.017G087300.2 pacid=42813340 polypeptide=Potri.017G087300.2.p locus=Potri.017G087300 ID=Potri.017G087300.2.v4.1 annot-version=v4.1 MVQEAIDGVPLRNTCRTVIRVPPGVYWQPVPEVTSLTWNNTSTKNDHHQASRVIETGTFRCGTVVVEGEGFITETITFEKFSPEVNTVLDNCFLLAIGCV RMYDSRCSGQAVAIRVTADWYAFYNCLFIGWQDTLYLHYGKQYLKDCYIEGYVDFIFGNITALLEHCHIQCKSAGLLIAQSIKSSQESTGYVFPRWGTSY MCLERPWGLFGRIIVADMALRIPYSAQKL

---

DESeq2's median of ratios [POPLAR]

Mapped by: StringTie Salmon Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	NWA:WT	NWB:WT	NWA:OE-ARK2	NWB:OE-ARK2	NWA:miRNA-ARK2	NWB:miRNA-ARK2	NW 0hr	WT H20	WT-NW	TUA1dEY NW	TUA1dEY+TUB15 NW	TUA1dY+TUB9 NW	Pde NW	NWA:WT GA	NWBWT GA	TW:WT	TW:WT GA	NWA:OE-ARK2 GA	NWB:OE-ARK2 GA	TW:OE-ARK2	TW:OE-ARK2 GA	NWA:miRNA-ARK2 GA	NWB:miRNA-ARK2 GA	TW:miRNA-ARK2	TW:miRNA-ARK2 GA	TW 2hr	TW 8hr	TW 24hr	TW 48hr	TW 96hr	TW 336hr	WT ACC	35S::etr1-1 H20	35S::etr1-1 ACC	LMX5::etr1-1 H20	LMX5::etr1-1 ACC	WT-TW	TUA1dEY TW	TUA1dEY+TUB15 TW	TUA1dY+TUB9 TW	Pde TW	OW:WT	OW:WT GA	OW:OE-ARK2	OW:OE-ARK2 GA	OW:miRNA-ARK2	OW:miRNA-ARK2 GA	OW 2hr	OW 8hr	OW 24hr	OW 48hr	OW 96hr	OW 336hr	Root CTR	Root LongCold	Root LongDrougt	Root LongHeat	Root LongSalt	Root ShortCold	Root ShortDrougt	Root ShortHeat	Root ShortSalt	Ptr root	Leaf CTR	Leaf LongCold	Leaf LongDrougt	Leaf LongHeat	Leaf LongSalt	Leaf ShortCold	Leaf ShortDrougt	Leaf ShortHeat	Leaf ShortSalt	Ptr leaf	Stem CTR	Stem LongCold	Stem LongDrougt	Stem LongHeat	Stem LongSalt	Stem ShortCold	Stem ShortDrougt	Stem ShortHeat	Stem ShortSalt	Ptr shoot	Ptr xylem	Ptr phloem	Ptr fiber	Ptr vessel	Ptr fiber vessel ray
AT3G29090		PME31, ATPME31	A. THALIANA PECTIN METHYLESTER...		Potri.017G087300 [exp]	0	1
AT3G47640	bHLH	PYE, bHLH047, P...	POPEYE, basic helix-loop-helix...		Potri.003G074400 [exp]	1.41	0.6879
AT5G45290			RING/U-box superfamily protein...		Potri.006G190500 [exp]	10.39	0.6687
AT1G01760			adenosine deaminases;RNA bindi...		Potri.014G081400 [exp]	12.00	0.6570
AT2G14285			Small nuclear ribonucleoprotei...		Potri.006G167000 [exp]	17.29	0.6249
AT5G13690		NAGLU, CYL1	N-ACETYL-GLUCOSAMINIDASE, CYCL...		Potri.012G075932 [exp]	20.19	0.6435
					Potri.001G149001 [exp]	21.49	0.6148
AT3G12680	C3HZnF	HUA1	ENHANCER OF AG-4 1, floral hom...		Potri.008G080300 [exp]	26.19	0.6248	Pt-HUA1.1
AT3G03300		ATDCL2, DCL2	dicer-like 2 (.1.2.3)		Potri.008G075900 [exp]	33.82	0.6270	DCL903
					Potri.014G187450 [exp]	40.21	0.5806
AT3G60830		ATARP7	actin-related protein 7 (.1)		Potri.001G265200 [exp]	40.39	0.5808	ARP7.1,ARP903

Compare expression of checked genes

Potri.017G087300 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.