Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser] Popgenie AspWood
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT1G69390 87 / 7e-23 ARC12, ATMINE1 accumulation and replication of chloroplasts 12, homologue of bacterial MinE 1 (.1)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.004G121000 [exp] 110 / 2e-32 AT1G69390 191 / 2e-61 accumulation and replication of chloroplasts 12, homologue of bacterial MinE 1 (.1) Potri.008G092300 [exp] 87 / 1e-22 AT1G69390 270 / 2e-92 accumulation and replication of chloroplasts 12, homologue of bacterial MinE 1 (.1) Potri.010G162600 [exp] 86 / 2e-22 AT1G69390 272 / 5e-93 accumulation and replication of chloroplasts 12, homologue of bacterial MinE 1 (.1)
Flax homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10026638 [exp] 90 / 7e-24 AT1G69390 247 / 4e-83 accumulation and replication of chloroplasts 12, homologue of bacterial MinE 1 (.1) Lus10036802 [exp] 88 / 5e-23 AT1G69390 253 / 3e-85 accumulation and replication of chloroplasts 12, homologue of bacterial MinE 1 (.1) Lus10030421 [exp] 86 / 2e-22 AT1G69390 248 / 9e-84 accumulation and replication of chloroplasts 12, homologue of bacterial MinE 1 (.1) Lus10037128 [exp] 83 / 3e-21 AT1G69390 256 / 2e-86 accumulation and replication of chloroplasts 12, homologue of bacterial MinE 1 (.1)
PFAM info
Representative CDS sequence Show only first row Show all	>Potri.017G088401.1 pacid=42814001 polypeptide=Potri.017G088401.1.p locus=Potri.017G088401 ID=Potri.017G088401.1.v4.1 annot-version=v4.1 ATGCAACATAGCTGTGCAGTCATTTTTGAGGCGAAGCAGAAGGTCTTGAGCAATGTTGTGGATACTCTATCTGATATTCTGGAGATAGACTCAGAGGATA AAGTCCAGCTTAGTGTATCAGCAGATGCAGATTTGGGGACCATCTACTCTATCACAGTTCCTGTTCGGCGTTTGAAGCCTGAGTATTATGATGAGGAAGA TCTTGAGGCTTTGAGCCTTTGA
AA sequence Show only first row Show all	>Potri.017G088401.1 pacid=42814001 polypeptide=Potri.017G088401.1.p locus=Potri.017G088401 ID=Potri.017G088401.1.v4.1 annot-version=v4.1 MQHSCAVIFEAKQKVLSNVVDTLSDILEIDSEDKVQLSVSADADLGTIYSITVPVRRLKPEYYDEEDLEALSL

---

DESeq2's median of ratios [POPLAR]

Mapped by: StringTie Salmon Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	NWA:WT	NWB:WT	NWA:OE-ARK2	NWB:OE-ARK2	NWA:miRNA-ARK2	NWB:miRNA-ARK2	NW 0hr	WT H20	WT-NW	TUA1dEY NW	TUA1dEY+TUB15 NW	TUA1dY+TUB9 NW	Pde NW	NWA:WT GA	NWBWT GA	TW:WT	TW:WT GA	NWA:OE-ARK2 GA	NWB:OE-ARK2 GA	TW:OE-ARK2	TW:OE-ARK2 GA	NWA:miRNA-ARK2 GA	NWB:miRNA-ARK2 GA	TW:miRNA-ARK2	TW:miRNA-ARK2 GA	TW 2hr	TW 8hr	TW 24hr	TW 48hr	TW 96hr	TW 336hr	WT ACC	35S::etr1-1 H20	35S::etr1-1 ACC	LMX5::etr1-1 H20	LMX5::etr1-1 ACC	WT-TW	TUA1dEY TW	TUA1dEY+TUB15 TW	TUA1dY+TUB9 TW	Pde TW	OW:WT	OW:WT GA	OW:OE-ARK2	OW:OE-ARK2 GA	OW:miRNA-ARK2	OW:miRNA-ARK2 GA	OW 2hr	OW 8hr	OW 24hr	OW 48hr	OW 96hr	OW 336hr	Root CTR	Root LongCold	Root LongDrougt	Root LongHeat	Root LongSalt	Root ShortCold	Root ShortDrougt	Root ShortHeat	Root ShortSalt	Ptr root	Leaf CTR	Leaf LongCold	Leaf LongDrougt	Leaf LongHeat	Leaf LongSalt	Leaf ShortCold	Leaf ShortDrougt	Leaf ShortHeat	Leaf ShortSalt	Ptr leaf	Stem CTR	Stem LongCold	Stem LongDrougt	Stem LongHeat	Stem LongSalt	Stem ShortCold	Stem ShortDrougt	Stem ShortHeat	Stem ShortSalt	Ptr shoot	Ptr xylem	Ptr phloem	Ptr fiber	Ptr vessel	Ptr fiber vessel ray
AT1G69390		ARC12, ATMINE1	accumulation and replication o...		Potri.017G088401 [exp]	0	1
					Potri.016G004700 [exp]	2.82	0.5899
AT5G12000			Protein kinase protein with ad...		Potri.006G225300 [exp]	13.19	0.5205
AT5G61630			unknown protein		Potri.001G080500 [exp]	19.89	0.5118
AT5G18310			unknown protein		Potri.015G040500 [exp]	31.73	0.4873
AT3G05675			BTB/POZ domain-containing prot...		Potri.016G069566 [exp]	87.41	0.4140
AT1G40390			DNAse I-like superfamily prote...		Potri.014G186733 [exp]	200.32	0.4259

Compare expression of checked genes

Potri.017G088401 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.