Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser] Popgenie AspWood
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT5G39240 64 / 2e-14 unknown protein AT3G29370 55 / 4e-11 P1R3 P1R3, unknown protein AT2G47270 39 / 7e-05 bHLH bHLH151, UPB1 UPBEAT1, sequence-specific DNA binding transcription factors;transcription regulators (.1) AT3G58850 37 / 0.0006 HLH2, PAR2 phy rapidly regulated 2 (.1)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.004G119600 [exp] 129 / 2e-40 AT5G39240 60 / 6e-13 unknown protein Potri.014G118300 [exp] 46 / 3e-07 AT2G47270 62 / 2e-13 UPBEAT1, sequence-specific DNA binding transcription factors;transcription regulators (.1) Potri.002G060100 [exp] 42 / 9e-06 AT3G58850 80 / 4e-20 phy rapidly regulated 2 (.1) Potri.002G193300 [exp] 42 / 1e-05 AT2G47270 79 / 5e-20 UPBEAT1, sequence-specific DNA binding transcription factors;transcription regulators (.1) Potri.005G201500 [exp] 40 / 4e-05 AT3G58850 82 / 4e-21 phy rapidly regulated 2 (.1)
Flax homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10002419 [exp] 39 / 0.0001 AT2G47270 67 / 4e-16 UPBEAT1, sequence-specific DNA binding transcription factors;transcription regulators (.1) Lus10030844 [exp] 37 / 0.0005 AT1G23965 48 / 2e-08 unknown protein Lus10001447 [exp] 37 / 0.0005 AT2G47270 69 / 2e-16 UPBEAT1, sequence-specific DNA binding transcription factors;transcription regulators (.1)
PFAM info
Representative CDS sequence Show only first row Show all	>Potri.017G093000.2 pacid=42812866 polypeptide=Potri.017G093000.2.p locus=Potri.017G093000 ID=Potri.017G093000.2.v4.1 annot-version=v4.1 ATGAGCTCAATGCCAGCCAAGTCCAAGATCTCACTAAAAAAGACTGCAAGAAGAAGAAGAAGACTGCCACATGCAGGTGCTTGCAAAGCTCAAAGAGGCA TTTACAATGGTGGGCTCACAAGCTCCTGCAGCAAGGTCTCGGACAAGTTAGAGGCTCTCAAGAACCTCATTCCAGCTACCTGCCACAATGGAGAGATTGT AAAACCTGACCAGTTGTTTAAAGAAACCGCTGATTATATTCTCCTCTTGAGGACCCAAGTTGTTTTATTGCAGGGTTTGGTTGAATTTTACGGATCCAGT ACTCCTGAAAGAGAAAATAACTCTGTGTTATAG
AA sequence Show only first row Show all	>Potri.017G093000.2 pacid=42812866 polypeptide=Potri.017G093000.2.p locus=Potri.017G093000 ID=Potri.017G093000.2.v4.1 annot-version=v4.1 MSSMPAKSKISLKKTARRRRRLPHAGACKAQRGIYNGGLTSSCSKVSDKLEALKNLIPATCHNGEIVKPDQLFKETADYILLLRTQVVLLQGLVEFYGSS TPERENNSVL

---

DESeq2's median of ratios [POPLAR]

Mapped by: StringTie Salmon Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	NWA:WT	NWB:WT	NWA:OE-ARK2	NWB:OE-ARK2	NWA:miRNA-ARK2	NWB:miRNA-ARK2	NW 0hr	WT H20	WT-NW	TUA1dEY NW	TUA1dEY+TUB15 NW	TUA1dY+TUB9 NW	Pde NW	NWA:WT GA	NWBWT GA	TW:WT	TW:WT GA	NWA:OE-ARK2 GA	NWB:OE-ARK2 GA	TW:OE-ARK2	TW:OE-ARK2 GA	NWA:miRNA-ARK2 GA	NWB:miRNA-ARK2 GA	TW:miRNA-ARK2	TW:miRNA-ARK2 GA	TW 2hr	TW 8hr	TW 24hr	TW 48hr	TW 96hr	TW 336hr	WT ACC	35S::etr1-1 H20	35S::etr1-1 ACC	LMX5::etr1-1 H20	LMX5::etr1-1 ACC	WT-TW	TUA1dEY TW	TUA1dEY+TUB15 TW	TUA1dY+TUB9 TW	Pde TW	OW:WT	OW:WT GA	OW:OE-ARK2	OW:OE-ARK2 GA	OW:miRNA-ARK2	OW:miRNA-ARK2 GA	OW 2hr	OW 8hr	OW 24hr	OW 48hr	OW 96hr	OW 336hr	Root CTR	Root LongCold	Root LongDrougt	Root LongHeat	Root LongSalt	Root ShortCold	Root ShortDrougt	Root ShortHeat	Root ShortSalt	Ptr root	Leaf CTR	Leaf LongCold	Leaf LongDrougt	Leaf LongHeat	Leaf LongSalt	Leaf ShortCold	Leaf ShortDrougt	Leaf ShortHeat	Leaf ShortSalt	Ptr leaf	Stem CTR	Stem LongCold	Stem LongDrougt	Stem LongHeat	Stem LongSalt	Stem ShortCold	Stem ShortDrougt	Stem ShortHeat	Stem ShortSalt	Ptr shoot	Ptr xylem	Ptr phloem	Ptr fiber	Ptr vessel	Ptr fiber vessel ray
AT5G39240			unknown protein		Potri.017G093000 [exp]	0	1
AT4G30320			CAP (Cysteine-rich secretory p...		Potri.006G171300 [exp]	1.73	0.8505
AT4G23820			Pectin lyase-like superfamily ...		Potri.003G139100 [exp]	3.00	0.8700
AT1G24620			EF hand calcium-binding protei...		Potri.010G107100 [exp]	4.47	0.8236
AT5G46290		KAS1, KAS I, KA...	KETOACYL-ACP SYNTHASE 1, 3-ket...		Potri.003G142000 [exp]	5.83	0.8514
AT5G35740			Carbohydrate-binding X8 domain...		Potri.014G164600 [exp]	6.00	0.8069
AT5G10160			Thioesterase superfamily prote...		Potri.003G020300 [exp]	7.41	0.8219
AT1G69530		ATHEXPALPHA1.2,...	EXPANSIN 1, expansin A1 (.1.2....		Potri.010G167200 [exp]	9.21	0.7825	EXPA1.1,PtEXPA3
AT3G25860		PLE2, LTA2	PLASTID E2 SUBUNIT OF PYRUVATE...		Potri.010G126600 [exp]	9.89	0.8147
AT3G05020		ACP1	acyl carrier protein 1 (.1)		Potri.013G031300 [exp]	10.95	0.8138
AT3G08030			Protein of unknown function, D...		Potri.001G263900 [exp]	12.00	0.8152

Compare expression of checked genes

Potri.017G093000 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.