Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser] Popgenie AspWood
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT3G29400 129 / 6e-35 ATEXO70E1 exocyst subunit exo70 family protein E1 (.1) AT5G50380 115 / 6e-30 ATEXO70F1 exocyst subunit exo70 family protein F1 (.1) AT1G54090 108 / 2e-27 ATEXO70D2 exocyst subunit exo70 family protein D2 (.1) AT5G61010 102 / 1e-25 ATEXO70E2 exocyst subunit exo70 family protein E2 (.1.2) AT5G58430 100 / 5e-25 ATEXO70B1 exocyst subunit exo70 family protein B1 (.1) AT1G72470 100 / 9e-25 ATEXO70D1 exocyst subunit exo70 family protein D1 (.1) AT3G14090 98 / 6e-24 ATEXO70D3 exocyst subunit exo70 family protein D3 (.1) AT1G07000 92 / 6e-22 ATEXO70B2 exocyst subunit exo70 family protein B2 (.1) AT2G28650 76 / 2e-16 ATEXO70H8 exocyst subunit exo70 family protein H8 (.1) AT5G59730 74 / 1e-15 ATEXO70H7 exocyst subunit exo70 family protein H7 (.1.2)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.017G093966 [exp] 202 / 5e-62 AT3G29400 597 / 0.0 exocyst subunit exo70 family protein E1 (.1) Potri.017G093700 [exp] 150 / 1e-42 AT3G29400 404 / 4e-132 exocyst subunit exo70 family protein E1 (.1) Potri.017G093833 [exp] 143 / 1e-39 AT3G29400 318 / 1e-98 exocyst subunit exo70 family protein E1 (.1) Potri.015G058200 [exp] 128 / 9e-35 AT5G61010 585 / 0.0 exocyst subunit exo70 family protein E2 (.1.2) Potri.012G097100 [exp] 121 / 3e-32 AT5G50380 754 / 0.0 exocyst subunit exo70 family protein F1 (.1) Potri.015G094800 [exp] 114 / 9e-30 AT5G50380 785 / 0.0 exocyst subunit exo70 family protein F1 (.1) Potri.001G166400 [exp] 111 / 9e-29 AT1G72470 822 / 0.0 exocyst subunit exo70 family protein D1 (.1) Potri.003G068700 [exp] 103 / 5e-26 AT1G72470 810 / 0.0 exocyst subunit exo70 family protein D1 (.1) Potri.013G152900 [exp] 99 / 3e-24 AT5G58430 781 / 0.0 exocyst subunit exo70 family protein B1 (.1)
Flax homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10035146 [exp] 182 / 6e-54 AT3G29400 579 / 0.0 exocyst subunit exo70 family protein E1 (.1) Lus10031956 [exp] 179 / 6e-53 AT3G29400 581 / 0.0 exocyst subunit exo70 family protein E1 (.1) Lus10016764 [exp] 130 / 2e-35 AT5G50380 807 / 0.0 exocyst subunit exo70 family protein F1 (.1) Lus10022459 [exp] 129 / 6e-35 AT5G50380 749 / 0.0 exocyst subunit exo70 family protein F1 (.1) Lus10008126 [exp] 110 / 4e-28 AT1G72470 862 / 0.0 exocyst subunit exo70 family protein D1 (.1) Lus10013163 [exp] 102 / 7e-26 AT1G72470 740 / 0.0 exocyst subunit exo70 family protein D1 (.1) Lus10022795 [exp] 76 / 6e-16 AT5G58430 796 / 0.0 exocyst subunit exo70 family protein B1 (.1) Lus10041536 [exp] 75 / 9e-16 AT5G13990 608 / 0.0 exocyst subunit exo70 family protein C2 (.1) Lus10034151 [exp] 74 / 2e-15 AT5G03540 991 / 0.0 exocyst subunit exo70 family protein A1 (.1.2.3) Lus10043432 [exp] 74 / 2e-15 AT5G03540 1004 / 0.0 exocyst subunit exo70 family protein A1 (.1.2.3)
PFAM info	Clan ID Clan name Pfam ID Pfam name Pfam description CL0295 [poplar] [flax] Vps51 PF03081 [poplar] [flax] Exo70 Exo70 exocyst complex subunit
Representative CDS sequence Show only first row Show all	>Potri.017G093650.1 pacid=42813526 polypeptide=Potri.017G093650.1.p locus=Potri.017G093650 ID=Potri.017G093650.1.v4.1 annot-version=v4.1 ATGGCTCAGAAGTCTCTCTTGGCGATGAGTCATTCGAGGATTCACTGTGTAGATATGGCGTTACCAGAAATTCAAGAGGAATTCATCATTGATTTGGTTC AACCATTTACAGTTTCTCAGCTCAAACAGATTGCAAATTTGATGTTCATTTCTGGTTATGGTTCTGAATGCTCGCGGACATATATTAGCGTTCGAAGGGA TGCCTTGGATGAGTGTCTGTCTATTCTTGAAATGGAGAAACTGAGCATTGAAGATATGCTGAAATCGGAATTCCAGAGCTTAAAATCCAAGATCAAGAGA TGGACAGAAAACATTTGTTCGTGTCTTGCTAGTGAGAAAAGGCTCACAGTACAAATTTCTGGGGAGCTTGGAACAGTTAGTTTTGTCTGTTTTGCTGAGA ATTCAATGTTGCAGCTATTGAATTTTGGCAAAGCCAAATCTGTTGGTCTCCATGAACCAGAAAAGTTGTCCCCTGTTCTTGACATGTACATGGCCCTAGT AGATCTTCTTCCAGATATAGATTCTTTATACTCAACAGAGGATAGTTCGAGTTAG
AA sequence Show only first row Show all	>Potri.017G093650.1 pacid=42813526 polypeptide=Potri.017G093650.1.p locus=Potri.017G093650 ID=Potri.017G093650.1.v4.1 annot-version=v4.1 MAQKSLLAMSHSRIHCVDMALPEIQEEFIIDLVQPFTVSQLKQIANLMFISGYGSECSRTYISVRRDALDECLSILEMEKLSIEDMLKSEFQSLKSKIKR WTENICSCLASEKRLTVQISGELGTVSFVCFAENSMLQLLNFGKAKSVGLHEPEKLSPVLDMYMALVDLLPDIDSLYSTEDSSS

---

DESeq2's median of ratios [POPLAR]

Mapped by: StringTie Salmon Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	NWA:WT	NWB:WT	NWA:OE-ARK2	NWB:OE-ARK2	NWA:miRNA-ARK2	NWB:miRNA-ARK2	NW 0hr	WT H20	WT-NW	TUA1dEY NW	TUA1dEY+TUB15 NW	TUA1dY+TUB9 NW	Pde NW	NWA:WT GA	NWBWT GA	TW:WT	TW:WT GA	NWA:OE-ARK2 GA	NWB:OE-ARK2 GA	TW:OE-ARK2	TW:OE-ARK2 GA	NWA:miRNA-ARK2 GA	NWB:miRNA-ARK2 GA	TW:miRNA-ARK2	TW:miRNA-ARK2 GA	TW 2hr	TW 8hr	TW 24hr	TW 48hr	TW 96hr	TW 336hr	WT ACC	35S::etr1-1 H20	35S::etr1-1 ACC	LMX5::etr1-1 H20	LMX5::etr1-1 ACC	WT-TW	TUA1dEY TW	TUA1dEY+TUB15 TW	TUA1dY+TUB9 TW	Pde TW	OW:WT	OW:WT GA	OW:OE-ARK2	OW:OE-ARK2 GA	OW:miRNA-ARK2	OW:miRNA-ARK2 GA	OW 2hr	OW 8hr	OW 24hr	OW 48hr	OW 96hr	OW 336hr	Root CTR	Root LongCold	Root LongDrougt	Root LongHeat	Root LongSalt	Root ShortCold	Root ShortDrougt	Root ShortHeat	Root ShortSalt	Ptr root	Leaf CTR	Leaf LongCold	Leaf LongDrougt	Leaf LongHeat	Leaf LongSalt	Leaf ShortCold	Leaf ShortDrougt	Leaf ShortHeat	Leaf ShortSalt	Ptr leaf	Stem CTR	Stem LongCold	Stem LongDrougt	Stem LongHeat	Stem LongSalt	Stem ShortCold	Stem ShortDrougt	Stem ShortHeat	Stem ShortSalt	Ptr shoot	Ptr xylem	Ptr phloem	Ptr fiber	Ptr vessel	Ptr fiber vessel ray
AT3G29400		ATEXO70E1	exocyst subunit exo70 family p...		Potri.017G093650 [exp]	0	1
					Potri.012G100450 [exp]	3.00	0.8531
AT4G01500	B3	NGA4	NGATHA4, AP2/B3-like transcrip...		Potri.015G016450 [exp]	3.87	0.8433
AT1G64295			F-box associated ubiquitinatio...		Potri.010G224400 [exp]	4.00	0.8511
					Potri.004G088550 [exp]	4.79	0.7670
AT4G32340			Tetratricopeptide repeat (TPR)...		Potri.006G254300 [exp]	6.32	0.8426
					Potri.002G003050 [exp]	8.66	0.8353
AT4G31020			alpha/beta-Hydrolases superfam...		Potri.018G111400 [exp]	10.58	0.8132
AT5G10530			Concanavalin A-like lectin pro...		Potri.007G004500 [exp]	11.40	0.8120
					Potri.001G027950 [exp]	11.48	0.8028
AT3G15880		WSIP2, TPR4	TOPLESS-RELATED 4, WUS-interac...		Potri.018G128000 [exp]	14.14	0.7499

Compare expression of checked genes

Potri.017G093650 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.