Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser] Popgenie AspWood
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT3G51550 56 / 8e-10 FER FERONIA, Malectin/receptor-like protein kinase family protein (.1) AT5G39020 56 / 1e-09 Malectin/receptor-like protein kinase family protein (.1) AT5G39000 51 / 4e-08 Malectin/receptor-like protein kinase family protein (.1) AT5G39030 50 / 7e-08 Protein kinase superfamily protein (.1) AT4G00300 47 / 6e-07 fringe-related protein (.1.2) AT5G38990 46 / 2e-06 Malectin/receptor-like protein kinase family protein (.1) AT5G59700 46 / 2e-06 Protein kinase superfamily protein (.1) AT4G39110 45 / 3e-06 Malectin/receptor-like protein kinase family protein (.1) AT5G61350 44 / 2e-05 Protein kinase superfamily protein (.1) AT1G30570 41 / 8e-05 HERK2 hercules receptor kinase 2 (.1)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.017G097001 [exp] 236 / 5e-75 AT3G51550 506 / 2e-168 FERONIA, Malectin/receptor-like protein kinase family protein (.1) Potri.017G095566 [exp] 164 / 2e-49 AT3G51550 270 / 2e-81 FERONIA, Malectin/receptor-like protein kinase family protein (.1) Potri.017G095900 [exp] 71 / 3e-15 AT3G51550 845 / 0.0 FERONIA, Malectin/receptor-like protein kinase family protein (.1) Potri.017G096800 [exp] 71 / 4e-15 AT3G51550 823 / 0.0 FERONIA, Malectin/receptor-like protein kinase family protein (.1) Potri.017G096000 [exp] 69 / 2e-14 AT3G51550 832 / 0.0 FERONIA, Malectin/receptor-like protein kinase family protein (.1) Potri.017G096600 [exp] 62 / 6e-12 AT3G51550 829 / 0.0 FERONIA, Malectin/receptor-like protein kinase family protein (.1) Potri.006G110000 [exp] 59 / 6e-11 AT3G51550 1256 / 0.0 FERONIA, Malectin/receptor-like protein kinase family protein (.1) Potri.016G138700 [exp] 56 / 1e-09 AT3G51550 1252 / 0.0 FERONIA, Malectin/receptor-like protein kinase family protein (.1) Potri.008G105500 [exp] 49 / 1e-07 AT3G04690 999 / 0.0 ANXUR1, Malectin/receptor-like protein kinase family protein (.1)
Flax homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10032976 [exp] 69 / 4e-14 AT3G51550 682 / 0.0 FERONIA, Malectin/receptor-like protein kinase family protein (.1) Lus10032971 [exp] 64 / 1e-12 AT3G51550 706 / 0.0 FERONIA, Malectin/receptor-like protein kinase family protein (.1) Lus10003942 [exp] 57 / 5e-10 AT3G51550 656 / 0.0 FERONIA, Malectin/receptor-like protein kinase family protein (.1) Lus10014185 [exp] 56 / 1e-09 AT3G51550 1254 / 0.0 FERONIA, Malectin/receptor-like protein kinase family protein (.1) Lus10022728 [exp] 56 / 1e-09 AT3G51550 1184 / 0.0 FERONIA, Malectin/receptor-like protein kinase family protein (.1) Lus10038487 [exp] 49 / 3e-07 AT5G59700 293 / 1e-90 Protein kinase superfamily protein (.1) Lus10029945 [exp] 45 / 6e-06 AT3G51550 424 / 1e-137 FERONIA, Malectin/receptor-like protein kinase family protein (.1) Lus10042844 [exp] 44 / 2e-05 AT3G46290 1025 / 0.0 hercules receptor kinase 1 (.1) Lus10028140 [exp] 42 / 5e-05 AT3G46290 1024 / 0.0 hercules receptor kinase 1 (.1) Lus10030308 [exp] 42 / 8e-05 AT3G46290 735 / 0.0 hercules receptor kinase 1 (.1)
PFAM info
Representative CDS sequence Show only first row Show all	>Potri.017G096100.2 pacid=42812956 polypeptide=Potri.017G096100.2.p locus=Potri.017G096100 ID=Potri.017G096100.2.v4.1 annot-version=v4.1 ATGAGTAGCAGCAGCAGCAGCAAATATCTCTCTCTCACAAACTCATCTTTATTCACACCTCTGCACCTCTCCTTCCTGTTCCTCCATCTCACCATCCTTG TAACCGGGGATTTACCACCACCTTACGTCCCTCTCGATAGCATAGCGCTTGATTGTGGTTCATCCGCCAATAGTGTTGGAAACGTTGGGCAATGGACTGC AGACATCAACTCAAGAGTGGCCCTTCTAGATCAAAACAACCTCTCAACACATCCCACAGAAAATGTAGCCTCCACTAGCTTTGTACCTTATTATACTGCT CGCGTCACTCTCTCCCAATTCACCTACACGTTTCGTGTCAACAAAACAGGACCTAAGTTTGTTCGCCTCCATTTTAATCCTGCTTCCTACACTGGTTTCT GTAAACAATTATGA
AA sequence Show only first row Show all	>Potri.017G096100.2 pacid=42812956 polypeptide=Potri.017G096100.2.p locus=Potri.017G096100 ID=Potri.017G096100.2.v4.1 annot-version=v4.1 MSSSSSSKYLSLTNSSLFTPLHLSFLFLHLTILVTGDLPPPYVPLDSIALDCGSSANSVGNVGQWTADINSRVALLDQNNLSTHPTENVASTSFVPYYTA RVTLSQFTYTFRVNKTGPKFVRLHFNPASYTGFCKQL

---

DESeq2's median of ratios [POPLAR]

Mapped by: StringTie Salmon Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	NWA:WT	NWB:WT	NWA:OE-ARK2	NWB:OE-ARK2	NWA:miRNA-ARK2	NWB:miRNA-ARK2	NW 0hr	WT H20	WT-NW	TUA1dEY NW	TUA1dEY+TUB15 NW	TUA1dY+TUB9 NW	Pde NW	NWA:WT GA	NWBWT GA	TW:WT	TW:WT GA	NWA:OE-ARK2 GA	NWB:OE-ARK2 GA	TW:OE-ARK2	TW:OE-ARK2 GA	NWA:miRNA-ARK2 GA	NWB:miRNA-ARK2 GA	TW:miRNA-ARK2	TW:miRNA-ARK2 GA	TW 2hr	TW 8hr	TW 24hr	TW 48hr	TW 96hr	TW 336hr	WT ACC	35S::etr1-1 H20	35S::etr1-1 ACC	LMX5::etr1-1 H20	LMX5::etr1-1 ACC	WT-TW	TUA1dEY TW	TUA1dEY+TUB15 TW	TUA1dY+TUB9 TW	Pde TW	OW:WT	OW:WT GA	OW:OE-ARK2	OW:OE-ARK2 GA	OW:miRNA-ARK2	OW:miRNA-ARK2 GA	OW 2hr	OW 8hr	OW 24hr	OW 48hr	OW 96hr	OW 336hr	Root CTR	Root LongCold	Root LongDrougt	Root LongHeat	Root LongSalt	Root ShortCold	Root ShortDrougt	Root ShortHeat	Root ShortSalt	Ptr root	Leaf CTR	Leaf LongCold	Leaf LongDrougt	Leaf LongHeat	Leaf LongSalt	Leaf ShortCold	Leaf ShortDrougt	Leaf ShortHeat	Leaf ShortSalt	Ptr leaf	Stem CTR	Stem LongCold	Stem LongDrougt	Stem LongHeat	Stem LongSalt	Stem ShortCold	Stem ShortDrougt	Stem ShortHeat	Stem ShortSalt	Ptr shoot	Ptr xylem	Ptr phloem	Ptr fiber	Ptr vessel	Ptr fiber vessel ray
AT3G51550		FER	FERONIA, Malectin/receptor-lik...		Potri.017G096100 [exp]	0	1
AT4G23180		RLK4, CRK10	cysteine-rich RLK (RECEPTOR-li...		Potri.004G024140 [exp]	1.73	0.9656
					Potri.018G088701 [exp]	2.82	0.9550
AT1G29740			Leucine-rich repeat transmembr...		Potri.011G072816 [exp]	3.31	0.9308
AT4G23180		RLK4, CRK10	cysteine-rich RLK (RECEPTOR-li...		Potri.004G023964 [exp]	4.89	0.9587
AT5G14180		MPL1	Myzus persicae-induced lipase ...		Potri.014G159800 [exp]	6.48	0.9399
AT4G23180		RLK4, CRK10	cysteine-rich RLK (RECEPTOR-li...		Potri.004G024000 [exp]	8.12	0.9486
AT4G18550		AtDSEL	Arabidopsis thaliana DAD1-like...		Potri.015G026500 [exp]	9.79	0.8796
AT1G62300	WRKY	ATWRKY6, WRKY6	WRKY family transcription fact...		Potri.014G155100 [exp]	10.95	0.9307
AT5G17910			unknown protein		Potri.001G249000 [exp]	12.32	0.9135
AT1G47890		AtRLP7	receptor like protein 7 (.1)		Potri.010G010100 [exp]	12.36	0.9333

Compare expression of checked genes

Potri.017G096100 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.