Potri.017G096366 [POPLAR]


External link
JGI Phytozome v13PopgenieAspWood                  
Symbol
Arabidopsis homologues

No hit found

Paralogs
Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Potri.017G098166 87 / 2e-24 ND /
Flax homologues

No hit found

PFAM info
Representative CDS sequence
>Potri.017G096366.1 pacid=42813522 polypeptide=Potri.017G096366.1.p locus=Potri.017G096366 ID=Potri.017G096366.1.v4.1 annot-version=v4.1
ATGTATTTCAGGTTGGTGTTCACCATAACAAATGCAGTAATCACAGCTCCGAGATTAGGCTTCAAAAGGTGCAAAGCTTCTTTTTCCTTATGGTCACCGC
CTTGTTACAATGATTGTCGCAAGTGTAAGGAACTAATAGGAGGCTCAAAGGATCGACCTATTCCTTTTTGGTTCATGAGTGTGCCTTTTTGGGCTGAGCT
TATAACCAAAAATCTTATCATCTGGTATAGTAATCGCTTACAAAACTTGGTTAATGATAAATCTTTCTTCCCATTAATCGAAGAATAA
AA sequence
>Potri.017G096366.1 pacid=42813522 polypeptide=Potri.017G096366.1.p locus=Potri.017G096366 ID=Potri.017G096366.1.v4.1 annot-version=v4.1
MYFRLVFTITNAVITAPRLGFKRCKASFSLWSPPCYNDCRKCKELIGGSKDRPIPFWFMSVPFWAELITKNLIIWYSNRLQNLVNDKSFFPLIEE

DESeq2's median of ratios [POPLAR]

Mapped by: Order by: Show schematic diagram

Coexpressed genes

Only top 10 genes are shown Show allDownload tab-delimited text
Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.
At best At TF class At alias At description Locus MR r Symbol NWA:WTNWB:WTNWA:OE-ARK2NWB:OE-ARK2NWA:miRNA-ARK2NWB:miRNA-ARK2NW 0hrWT H20WT-NWTUA1dEY NWTUA1dEY+TUB15 NWTUA1dY+TUB9 NWPde NWNWA:WT GANWBWT GATW:WTTW:WT GANWA:OE-ARK2 GANWB:OE-ARK2 GATW:OE-ARK2TW:OE-ARK2 GANWA:miRNA-ARK2 GANWB:miRNA-ARK2 GATW:miRNA-ARK2TW:miRNA-ARK2 GATW 2hrTW 8hrTW 24hrTW 48hrTW 96hrTW 336hrWT ACC35S::etr1-1 H2035S::etr1-1 ACCLMX5::etr1-1 H20LMX5::etr1-1 ACCWT-TWTUA1dEY TWTUA1dEY+TUB15 TWTUA1dY+TUB9 TWPde TWOW:WTOW:WT GAOW:OE-ARK2OW:OE-ARK2 GAOW:miRNA-ARK2OW:miRNA-ARK2 GAOW 2hrOW 8hrOW 24hrOW 48hrOW 96hrOW 336hrRoot CTRRoot LongColdRoot LongDrougtRoot LongHeatRoot LongSaltRoot ShortColdRoot ShortDrougtRoot ShortHeatRoot ShortSaltPtr rootLeaf CTRLeaf LongColdLeaf LongDrougtLeaf LongHeatLeaf LongSaltLeaf ShortColdLeaf ShortDrougtLeaf ShortHeatLeaf ShortSaltPtr leafStem CTRStem LongColdStem LongDrougtStem LongHeatStem LongSaltStem ShortColdStem ShortDrougtStem ShortHeatStem ShortSaltPtr shootPtr xylemPtr phloemPtr fiberPtr vesselPtr fiber vessel ray
Potri.017G096366 0 1
AT4G12731 unknown protein Potri.001G226500 7.48 0.7166
AT4G12735 unknown protein Potri.001G226754 13.07 0.7034
AT1G34630 unknown protein Potri.005G165100 22.04 0.6648
AT3G28210 SAP12, PMZ STRESS-ASSOCIATED PROTEIN 12, ... Potri.011G138500 23.91 0.6612 PMZ.1
AT1G09070 (AT)SRC2, (AT)S... soybean gene regulated by cold... Potri.005G026700 29.46 0.6965
AT5G13200 GRAM domain family protein (.1... Potri.003G165700 39.30 0.6505
AT4G15417 ATRTL1 RNAse II-like 1 (.1) Potri.002G226700 40.21 0.6743
AT1G17170 ATGSTU24 Arabidopsis thaliana Glutathio... Potri.011G113400 45.17 0.6556
Potri.009G018200 49.59 0.5679
AT3G62420 bZIP ATBZIP53 basic region/leucine zipper mo... Potri.014G120800 49.69 0.6219

Potri.017G096366 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.