Potri.017G098300 [POPLAR]


External link
JGI Phytozome v13PopgenieAspWood                  
Symbol
Arabidopsis homologues
Locus ID BLAST score/e-value TF class Alias TAIR10 short description
AT3G29780 50 / 6e-10 RALFL27 ralf-like 27 (.1)
Paralogs
Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Potri.017G096500 112 / 3e-34 AT3G29780 50 / 5e-09 ralf-like 27 (.1)
Potri.017G095700 100 / 2e-29 AT3G29780 46 / 2e-07 ralf-like 27 (.1)
Potri.017G096300 100 / 2e-29 AT3G29780 46 / 2e-07 ralf-like 27 (.1)
Potri.017G098100 100 / 2e-29 AT3G29780 46 / 2e-07 ralf-like 27 (.1)
Flax homologues

No hit found

PFAM info
Clan ID Clan name Pfam ID Pfam name Pfam description
PF05498 RALF Rapid ALkalinization Factor (RALF)
Representative CDS sequence
>Potri.017G098300.2 pacid=42814339 polypeptide=Potri.017G098300.2.p locus=Potri.017G098300 ID=Potri.017G098300.2.v4.1 annot-version=v4.1
ATGGAATCTGAAGTGCATCAGAGACTACTGGCCTCTCAGGGTAACTTTATTAACTATAGGAGTTTAGAACGACAACCAATTTGCAATGCACAAATATATG
GCAACTGTGCAAAACCGATCAATGGTAACACTCGGCCTTGCACTTACTACAATCGGTGCAAACGTGGTAGTTGA
AA sequence
>Potri.017G098300.2 pacid=42814339 polypeptide=Potri.017G098300.2.p locus=Potri.017G098300 ID=Potri.017G098300.2.v4.1 annot-version=v4.1
MESEVHQRLLASQGNFINYRSLERQPICNAQIYGNCAKPINGNTRPCTYYNRCKRGS

DESeq2's median of ratios [POPLAR]

Mapped by: Order by: Show schematic diagram

Coexpressed genes

Only top 10 genes are shown Show allDownload tab-delimited text
Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.
At best At TF class At alias At description Locus MR r Symbol NWA:WTNWB:WTNWA:OE-ARK2NWB:OE-ARK2NWA:miRNA-ARK2NWB:miRNA-ARK2NW 0hrWT H20WT-NWTUA1dEY NWTUA1dEY+TUB15 NWTUA1dY+TUB9 NWPde NWNWA:WT GANWBWT GATW:WTTW:WT GANWA:OE-ARK2 GANWB:OE-ARK2 GATW:OE-ARK2TW:OE-ARK2 GANWA:miRNA-ARK2 GANWB:miRNA-ARK2 GATW:miRNA-ARK2TW:miRNA-ARK2 GATW 2hrTW 8hrTW 24hrTW 48hrTW 96hrTW 336hrWT ACC35S::etr1-1 H2035S::etr1-1 ACCLMX5::etr1-1 H20LMX5::etr1-1 ACCWT-TWTUA1dEY TWTUA1dEY+TUB15 TWTUA1dY+TUB9 TWPde TWOW:WTOW:WT GAOW:OE-ARK2OW:OE-ARK2 GAOW:miRNA-ARK2OW:miRNA-ARK2 GAOW 2hrOW 8hrOW 24hrOW 48hrOW 96hrOW 336hrRoot CTRRoot LongColdRoot LongDrougtRoot LongHeatRoot LongSaltRoot ShortColdRoot ShortDrougtRoot ShortHeatRoot ShortSaltPtr rootLeaf CTRLeaf LongColdLeaf LongDrougtLeaf LongHeatLeaf LongSaltLeaf ShortColdLeaf ShortDrougtLeaf ShortHeatLeaf ShortSaltPtr leafStem CTRStem LongColdStem LongDrougtStem LongHeatStem LongSaltStem ShortColdStem ShortDrougtStem ShortHeatStem ShortSaltPtr shootPtr xylemPtr phloemPtr fiberPtr vesselPtr fiber vessel ray
AT3G29780 RALFL27 ralf-like 27 (.1) Potri.017G098300 0 1
AT3G29780 RALFL27 ralf-like 27 (.1) Potri.017G096500 1.00 0.9839 Pt-RALFL27.1
AT5G60440 MADS AGL62 AGAMOUS-like 62 (.1) Potri.006G258500 7.74 0.9080
AT1G14440 ZF_HD ATHB31, ZHD4 ZINC FINGER HOMEODOMAIN 4, hom... Potri.003G000400 10.58 0.8998
AT3G29780 RALFL27 ralf-like 27 (.1) Potri.017G098100 12.16 0.9110
Potri.004G050700 15.00 0.9006
AT2G03430 Ankyrin repeat family protein ... Potri.010G185200 15.29 0.8999
Potri.004G050600 16.24 0.9086
AT1G60550 ECHID, DHNS enoyl-CoA hydratase/isomerase ... Potri.001G329900 21.16 0.8801
AT3G01480 ATCYP38, CYP38 ARABIDOPSIS CYCLOPHILIN 38, cy... Potri.017G072800 28.28 0.8898
AT3G29780 RALFL27 ralf-like 27 (.1) Potri.017G096300 29.25 0.8958

Potri.017G098300 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.