Potri.017G098750 [POPLAR]


External link
JGI Phytozome v13PopgenieAspWood                  
Symbol
Arabidopsis homologues

No hit found

Paralogs
Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Potri.011G144433 43 / 2e-07 ND /
Flax homologues

No hit found

PFAM info
Clan ID Clan name Pfam ID Pfam name Pfam description
CL0054 Knottin_1 PF07333 SLR1-BP S locus-related glycoprotein 1 binding pollen coat protein (SLR1-BP)
Representative CDS sequence
>Potri.017G098750.1 pacid=42813678 polypeptide=Potri.017G098750.1.p locus=Potri.017G098750 ID=Potri.017G098750.1.v4.1 annot-version=v4.1
ATGAAAAGCCTTTCGATCACTCTCATCCTTCTTGTGGTTCTGCTTATCAACTGTGGGAATGAGCAAATGTTGGTGACTGCCCAGTGCGAGAAAGTACTGC
ATGGAGGTGGTTGTAAACCAGACGAATGTAGCAAGGGTTGTCAAGCCATGTATGGAGCAGCAGCCATGGGGCTTTGTTTCTTCTTCCAGAAGCCGAATGA
CACTTGTTTATGTCGATATCATTGCTAA
AA sequence
>Potri.017G098750.1 pacid=42813678 polypeptide=Potri.017G098750.1.p locus=Potri.017G098750 ID=Potri.017G098750.1.v4.1 annot-version=v4.1
MKSLSITLILLVVLLINCGNEQMLVTAQCEKVLHGGGCKPDECSKGCQAMYGAAAMGLCFFFQKPNDTCLCRYHC

DESeq2's median of ratios [POPLAR]

Mapped by: Order by: Show schematic diagram

Coexpressed genes

Only top 10 genes are shown Show allDownload tab-delimited text
Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.
At best At TF class At alias At description Locus MR r Symbol NWA:WTNWB:WTNWA:OE-ARK2NWB:OE-ARK2NWA:miRNA-ARK2NWB:miRNA-ARK2NW 0hrWT H20WT-NWTUA1dEY NWTUA1dEY+TUB15 NWTUA1dY+TUB9 NWPde NWNWA:WT GANWBWT GATW:WTTW:WT GANWA:OE-ARK2 GANWB:OE-ARK2 GATW:OE-ARK2TW:OE-ARK2 GANWA:miRNA-ARK2 GANWB:miRNA-ARK2 GATW:miRNA-ARK2TW:miRNA-ARK2 GATW 2hrTW 8hrTW 24hrTW 48hrTW 96hrTW 336hrWT ACC35S::etr1-1 H2035S::etr1-1 ACCLMX5::etr1-1 H20LMX5::etr1-1 ACCWT-TWTUA1dEY TWTUA1dEY+TUB15 TWTUA1dY+TUB9 TWPde TWOW:WTOW:WT GAOW:OE-ARK2OW:OE-ARK2 GAOW:miRNA-ARK2OW:miRNA-ARK2 GAOW 2hrOW 8hrOW 24hrOW 48hrOW 96hrOW 336hrRoot CTRRoot LongColdRoot LongDrougtRoot LongHeatRoot LongSaltRoot ShortColdRoot ShortDrougtRoot ShortHeatRoot ShortSaltPtr rootLeaf CTRLeaf LongColdLeaf LongDrougtLeaf LongHeatLeaf LongSaltLeaf ShortColdLeaf ShortDrougtLeaf ShortHeatLeaf ShortSaltPtr leafStem CTRStem LongColdStem LongDrougtStem LongHeatStem LongSaltStem ShortColdStem ShortDrougtStem ShortHeatStem ShortSaltPtr shootPtr xylemPtr phloemPtr fiberPtr vesselPtr fiber vessel ray
Potri.017G098750 0 1
AT5G28780 PIF1 helicase (.1) Potri.006G157501 18.97 1.0000
AT1G02790 PGA4 polygalacturonase 4 (.1) Potri.010G011200 21.54 1.0000
AT3G02310 MADS AGL4, SEP2 SEPALLATA 2, AGAMOUS-like 4, K... Potri.004G115500 28.74 1.0000
AT2G24370 Protein kinase protein with ad... Potri.018G002400 40.49 1.0000
Potri.006G055550 55.31 0.9414
AT5G60440 MADS AGL62 AGAMOUS-like 62 (.1) Potri.009G084200 58.24 0.9368
Potri.001G380550 59.19 0.9251
Potri.010G080666 60.44 0.9904
Potri.001G169351 67.52 1.0000
Potri.001G196900 68.23 1.0000

Potri.017G098750 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.