Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser] Popgenie AspWood
Symbol	Pt-MADS12.7
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT5G60910 256 / 7e-86 MADS FUL, AGL8 FRUITFULL, AGAMOUS-like 8 (.1.2) AT1G69120 252 / 3e-84 MADS AGL7, AP1 APETALA1, AGAMOUS-like 7, K-box region and MADS-box transcription factor family protein (.1) AT1G26310 241 / 4e-80 MADS CAL1, AGL10, CAL CAULIFLOWER, AGAMOUS-like 10, K-box region and MADS-box transcription factor family protein (.1) AT3G30260 192 / 6e-61 MADS AGL79 AGAMOUS-like 79 (.1) AT3G02310 176 / 2e-54 MADS AGL4, SEP2 SEPALLATA 2, AGAMOUS-like 4, K-box region and MADS-box transcription factor family protein (.1) AT1G24260 174 / 1e-53 MADS AGL9, SEP3 SEPALLATA3, AGAMOUS-like 9, K-box region and MADS-box transcription factor family protein (.1.2.3) AT5G15800 173 / 2e-53 MADS AGL2, SEP1 SEPALLATA1, AGAMOUS-like 2, K-box region and MADS-box transcription factor family protein (.1.2) AT2G45650 164 / 6e-50 MADS AGL6 AGAMOUS-like 6 (.1) AT3G61120 150 / 1e-44 MADS AGL13 AGAMOUS-like 13 (.1) AT2G03710 150 / 3e-44 MADS AGL3, SEP4 SEPALLATA 4, AGAMOUS-like 3, K-box region and MADS-box transcription factor family protein (.1.2.3)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.004G115400 [exp] 412 / 1e-147 AT5G60910 230 / 7e-76 FRUITFULL, AGAMOUS-like 8 (.1.2) Potri.010G154100 [exp] 283 / 1e-96 AT1G69120 324 / 7e-113 APETALA1, AGAMOUS-like 7, K-box region and MADS-box transcription factor family protein (.1) Potri.012G062300 [exp] 275 / 1e-93 AT5G60910 288 / 5e-99 FRUITFULL, AGAMOUS-like 8 (.1.2) Potri.008G098500 [exp] 274 / 3e-93 AT1G69120 336 / 9e-118 APETALA1, AGAMOUS-like 7, K-box region and MADS-box transcription factor family protein (.1) Potri.008G098400 [exp] 181 / 1e-56 AT5G15800 275 / 2e-93 SEPALLATA1, AGAMOUS-like 2, K-box region and MADS-box transcription factor family protein (.1.2) Potri.014G074100 [exp] 181 / 1e-56 AT2G45650 311 / 5e-108 AGAMOUS-like 6 (.1) Potri.004G115500 [exp] 181 / 1e-56 AT3G02310 357 / 4e-126 SEPALLATA 2, AGAMOUS-like 4, K-box region and MADS-box transcription factor family protein (.1) Potri.003G169600 [exp] 177 / 3e-55 AT1G24260 359 / 7e-127 SEPALLATA3, AGAMOUS-like 9, K-box region and MADS-box transcription factor family protein (.1.2.3) Potri.017G099700 [exp] 177 / 7e-55 AT3G02310 372 / 8e-132 SEPALLATA 2, AGAMOUS-like 4, K-box region and MADS-box transcription factor family protein (.1)
Flax homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10021140 [exp] 286 / 2e-97 AT5G60910 291 / 1e-99 FRUITFULL, AGAMOUS-like 8 (.1.2) Lus10007983 [exp] 283 / 2e-96 AT5G60910 298 / 3e-102 FRUITFULL, AGAMOUS-like 8 (.1.2) Lus10034662 [exp] 254 / 2e-85 AT5G60910 284 / 3e-97 FRUITFULL, AGAMOUS-like 8 (.1.2) Lus10026679 [exp] 254 / 2e-85 AT1G69120 338 / 1e-118 APETALA1, AGAMOUS-like 7, K-box region and MADS-box transcription factor family protein (.1) Lus10017871 [exp] 251 / 6e-85 AT1G69120 264 / 2e-90 APETALA1, AGAMOUS-like 7, K-box region and MADS-box transcription factor family protein (.1) Lus10004637 [exp] 247 / 5e-83 AT1G69120 318 / 2e-111 APETALA1, AGAMOUS-like 7, K-box region and MADS-box transcription factor family protein (.1) Lus10005081 [exp] 238 / 2e-78 AT1G69120 223 / 1e-72 APETALA1, AGAMOUS-like 7, K-box region and MADS-box transcription factor family protein (.1) Lus10034370 [exp] 231 / 3e-76 AT1G69120 224 / 1e-73 APETALA1, AGAMOUS-like 7, K-box region and MADS-box transcription factor family protein (.1) Lus10005080 [exp] 174 / 1e-53 AT3G02310 372 / 1e-131 SEPALLATA 2, AGAMOUS-like 4, K-box region and MADS-box transcription factor family protein (.1) Lus10034663 [exp] 174 / 2e-53 AT5G15800 267 / 4e-90 SEPALLATA1, AGAMOUS-like 2, K-box region and MADS-box transcription factor family protein (.1.2)
PFAM info	Clan ID Clan name Pfam ID Pfam name Pfam description PF00319 [poplar] [flax] SRF-TF SRF-type transcription factor (DNA-binding and dimerisation domain) PF01486 [poplar] [flax] K-box K-box region
Representative CDS sequence Show only first row Show all	>Potri.017G099800.1 pacid=42814472 polypeptide=Potri.017G099800.1.p locus=Potri.017G099800 ID=Potri.017G099800.1.v4.1 annot-version=v4.1 ATGGGGAGAGGTAGGGTTCAGTTGAAGAGGATCGAGAACAATATTAGCAGGCAAGTGACATTCTCCAAGAGAAGAACTGGTTTACTAAAGAAAGCTCATG AGATCTCTGTTCTCTGTGATGCTGATGTCGCTGTGATTGTTTTCTCTACAAAAGGGAAGCTCTTTGAGTACTCCACTGACTCCAGCATGGAATCGATCCT TGAAAGATACGAAAGATGCTCGTATGCAGAGCAGCAGTTTGTACCACATGGCCCTGAACATCAGGGAAGCTGGTTTTTGGAGCACCCAAAGCTCAGGGCT AGGGTTGAACTCTTGCAGAGAAACCTAAGGAACTATACAGGACAAGATTTGGACCCTTTAAGTTACAAAGAACTTCAACACCTGGAGCAAAAAATAGATA CTGCTCTTAAGAGCGTACGATCAAGAAAGAACCAACTCGTCCATGAATCCCTTGCAGAAATGCAGAAAAAAGAAAAGGCACTTCAGGACCAGAACAACAT ACTAGTAGAACAGGTCAAGAAAAAACTGAAGGCGCTAACCGAGCAAGCACAATGGGAGCAGCAAAACCTTGGCCAGAACTCATCCTCTTTTATGCTACCA CAAGCACAACCTCCACTGCAGCCGTCGATGCTATCACATCCTCCACCAACTATAGGTGGCAGTTTCCAGATTAGAGGATTCCTGAACGGTAACAAGGATG TTGAAGTTCAAACTCAACCTAGCACCATGCCACATTGGATGCTTCGCCATGTCAATGATAGAATTTGA
AA sequence Show only first row Show all	>Potri.017G099800.1 pacid=42814472 polypeptide=Potri.017G099800.1.p locus=Potri.017G099800 ID=Potri.017G099800.1.v4.1 annot-version=v4.1 MGRGRVQLKRIENNISRQVTFSKRRTGLLKKAHEISVLCDADVAVIVFSTKGKLFEYSTDSSMESILERYERCSYAEQQFVPHGPEHQGSWFLEHPKLRA RVELLQRNLRNYTGQDLDPLSYKELQHLEQKIDTALKSVRSRKNQLVHESLAEMQKKEKALQDQNNILVEQVKKKLKALTEQAQWEQQNLGQNSSSFMLP QAQPPLQPSMLSHPPPTIGGSFQIRGFLNGNKDVEVQTQPSTMPHWMLRHVNDRI

---

DESeq2's median of ratios [POPLAR]

Mapped by: StringTie Salmon Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	NWA:WT	NWB:WT	NWA:OE-ARK2	NWB:OE-ARK2	NWA:miRNA-ARK2	NWB:miRNA-ARK2	NW 0hr	WT H20	WT-NW	TUA1dEY NW	TUA1dEY+TUB15 NW	TUA1dY+TUB9 NW	Pde NW	NWA:WT GA	NWBWT GA	TW:WT	TW:WT GA	NWA:OE-ARK2 GA	NWB:OE-ARK2 GA	TW:OE-ARK2	TW:OE-ARK2 GA	NWA:miRNA-ARK2 GA	NWB:miRNA-ARK2 GA	TW:miRNA-ARK2	TW:miRNA-ARK2 GA	TW 2hr	TW 8hr	TW 24hr	TW 48hr	TW 96hr	TW 336hr	WT ACC	35S::etr1-1 H20	35S::etr1-1 ACC	LMX5::etr1-1 H20	LMX5::etr1-1 ACC	WT-TW	TUA1dEY TW	TUA1dEY+TUB15 TW	TUA1dY+TUB9 TW	Pde TW	OW:WT	OW:WT GA	OW:OE-ARK2	OW:OE-ARK2 GA	OW:miRNA-ARK2	OW:miRNA-ARK2 GA	OW 2hr	OW 8hr	OW 24hr	OW 48hr	OW 96hr	OW 336hr	Root CTR	Root LongCold	Root LongDrougt	Root LongHeat	Root LongSalt	Root ShortCold	Root ShortDrougt	Root ShortHeat	Root ShortSalt	Ptr root	Leaf CTR	Leaf LongCold	Leaf LongDrougt	Leaf LongHeat	Leaf LongSalt	Leaf ShortCold	Leaf ShortDrougt	Leaf ShortHeat	Leaf ShortSalt	Ptr leaf	Stem CTR	Stem LongCold	Stem LongDrougt	Stem LongHeat	Stem LongSalt	Stem ShortCold	Stem ShortDrougt	Stem ShortHeat	Stem ShortSalt	Ptr shoot	Ptr xylem	Ptr phloem	Ptr fiber	Ptr vessel	Ptr fiber vessel ray
AT5G60910	MADS	FUL, AGL8	FRUITFULL, AGAMOUS-like 8 (.1....		Potri.017G099800 [exp]	0	1	Pt-MADS12.7
					Potri.010G155701 [exp]	13.78	0.8424
AT5G18470			Curculin-like (mannose-binding...		Potri.013G050500 [exp]	19.59	0.8650
AT3G25140		QUA1, GAUT8	QUASIMODO 1, GALACTURONOSYLTRA...		Potri.008G010000 [exp]	26.53	0.8525
AT2G27240			Aluminium activated malate tra...		Potri.001G217050 [exp]	46.20	0.8128
					Potri.003G116550 [exp]	48.98	0.8298
AT1G25275			unknown protein		Potri.015G116800 [exp]	81.06	0.8013
AT3G48270		CYP71A26	"cytochrome P450, family 71, s...		Potri.015G085800 [exp]	145.32	0.7555	Pt-CYP71.2
AT1G37140		MCT1	MEI2 C-terminal RRM only like ...		Potri.002G088200 [exp]	150.63	0.7381
AT1G62420			Protein of unknown function (D...		Potri.004G001400 [exp]	169.89	0.7357
AT3G18010	HD	WOX1	WUSCHEL related homeobox 1 (.1...		Potri.010G111400 [exp]	184.27	0.7408

Compare expression of checked genes

Potri.017G099800 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.