Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser] Popgenie AspWood
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT5G36930 159 / 3e-45 Disease resistance protein (TIR-NBS-LRR class) family (.1), Disease resistance protein (TIR-NBS-LRR class) family (.2) AT1G72920 147 / 4e-44 Toll-Interleukin-Resistance (TIR) domain family protein (.1) AT1G72940 146 / 8e-43 Toll-Interleukin-Resistance (TIR) domain-containing protein (.1) AT1G72900 141 / 6e-41 Toll-Interleukin-Resistance (TIR) domain-containing protein (.1) AT1G72930 135 / 7e-41 TIR toll/interleukin-1 receptor-like (.1.2) AT1G72890 139 / 1e-39 Disease resistance protein (TIR-NBS class) (.1), Disease resistance protein (TIR-NBS class) (.2) AT5G17680 142 / 2e-39 disease resistance protein (TIR-NBS-LRR class), putative (.1) AT1G27170 141 / 4e-39 transmembrane receptors;ATP binding (.1.2) AT1G72840 138 / 5e-38 Disease resistance protein (TIR-NBS-LRR class) (.1), Disease resistance protein (TIR-NBS-LRR class) (.2) AT1G72910 133 / 6e-38 Toll-Interleukin-Resistance (TIR) domain-containing protein (.1)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.017G104301 [exp] 316 / 9e-101 AT5G17680 566 / 1e-178 disease resistance protein (TIR-NBS-LRR class), putative (.1) Potri.013G098100 [exp] 282 / 9e-99 AT5G36930 159 / 1e-45 Disease resistance protein (TIR-NBS-LRR class) family (.1), Disease resistance protein (TIR-NBS-LRR class) family (.2) Potri.013G097050 [exp] 280 / 4e-98 AT5G36930 158 / 3e-45 Disease resistance protein (TIR-NBS-LRR class) family (.1), Disease resistance protein (TIR-NBS-LRR class) family (.2) Potri.013G097300 [exp] 306 / 3e-97 AT5G17680 598 / 0.0 disease resistance protein (TIR-NBS-LRR class), putative (.1) Potri.013G096849 [exp] 276 / 4e-96 AT5G36930 167 / 4e-48 Disease resistance protein (TIR-NBS-LRR class) family (.1), Disease resistance protein (TIR-NBS-LRR class) family (.2) Potri.017G105201 [exp] 298 / 8e-95 AT4G12010 549 / 4e-174 Disease resistance protein (TIR-NBS-LRR class) family (.1) Potri.017G104901 [exp] 293 / 2e-92 AT5G17680 536 / 2e-167 disease resistance protein (TIR-NBS-LRR class), putative (.1) Potri.017G103701 [exp] 292 / 4e-92 AT5G17680 544 / 5e-170 disease resistance protein (TIR-NBS-LRR class), putative (.1) Potri.013G097000 [exp] 288 / 3e-91 AT5G17680 571 / 0.0 disease resistance protein (TIR-NBS-LRR class), putative (.1)
Flax homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10011104 [exp] 192 / 4e-57 AT5G17680 574 / 0.0 disease resistance protein (TIR-NBS-LRR class), putative (.1) Lus10030839 [exp] 179 / 3e-52 AT4G12010 552 / 7e-176 Disease resistance protein (TIR-NBS-LRR class) family (.1) Lus10006929 [exp] 163 / 1e-50 AT1G72890 146 / 1e-39 Disease resistance protein (TIR-NBS class) (.1), Disease resistance protein (TIR-NBS class) (.2) Lus10041060 [exp] 173 / 3e-50 AT5G17680 641 / 0.0 disease resistance protein (TIR-NBS-LRR class), putative (.1) Lus10042752 [exp] 158 / 8e-50 AT4G16990 145 / 5e-41 RESISTANCE TO LEPTOSPHAERIA MACULANS 3, disease resistance protein (TIR-NBS class), putative Lus10014671 [exp] 159 / 5e-49 AT5G36930 144 / 4e-39 Disease resistance protein (TIR-NBS-LRR class) family (.1), Disease resistance protein (TIR-NBS-LRR class) family (.2) Lus10006928 [exp] 165 / 1e-48 AT5G36930 165 / 5e-43 Disease resistance protein (TIR-NBS-LRR class) family (.1), Disease resistance protein (TIR-NBS-LRR class) family (.2) Lus10003749 [exp] 160 / 5e-46 AT5G17680 517 / 5e-161 disease resistance protein (TIR-NBS-LRR class), putative (.1) Lus10039850 [exp] 160 / 1e-45 AT5G36930 573 / 0.0 Disease resistance protein (TIR-NBS-LRR class) family (.1), Disease resistance protein (TIR-NBS-LRR class) family (.2) Lus10013729 [exp] 158 / 1e-45 AT5G36930 310 / 2e-92 Disease resistance protein (TIR-NBS-LRR class) family (.1), Disease resistance protein (TIR-NBS-LRR class) family (.2)
PFAM info	Clan ID Clan name Pfam ID Pfam name Pfam description CL0173 [poplar] [flax] STIR PF13676 [poplar] [flax] TIR_2 TIR domain
Representative CDS sequence Show only first row Show all	>Potri.017G105501.1 pacid=42813192 polypeptide=Potri.017G105501.1.p locus=Potri.017G105501 ID=Potri.017G105501.1.v4.1 annot-version=v4.1 ATGGCTTCCACCAGCGTGCAAGGAATAACCTCATCTTCATCTTCTTCTTCTTCTTCTCCTCCACTATATATGTATGATGTGTTCCTTAGTTTTAGAGGCA AAGACACCCGGAACAACTTTACTAGTCATCTATATTATAATCTGGCACAGAGAGGCATCGATGTGTACATGGATGATAGGGGGCTCGAGAGAGGAAAGAC CATCGAACCTGCTCTCTGGAAGGCCATCGAAGAATCAAGGTTTTCAGTCATTATATTTTCAAGAGAATACGCTTCTTCACCATGGTGCTTGGATGAACTT GTCAAGATTGTTCAGTGCATGAAAGAGACGGGGCACACTGTTCTGCCAATTTTTTATGATGTGGATCCCTCAGAGGTAGCCGAGCAGAAAGGGCAATATG AGAAAGCCTTCGTTGAGCATGAACAAAATTTCAAGGAAAACTTGGAGAAGGTCCGGAACTGGAAAGATTGTCTCTCTACGGTGGCCAATCTATCTGGCTG GGACGTCCGGAATAGGTAA
AA sequence Show only first row Show all	>Potri.017G105501.1 pacid=42813192 polypeptide=Potri.017G105501.1.p locus=Potri.017G105501 ID=Potri.017G105501.1.v4.1 annot-version=v4.1 MASTSVQGITSSSSSSSSSPPLYMYDVFLSFRGKDTRNNFTSHLYYNLAQRGIDVYMDDRGLERGKTIEPALWKAIEESRFSVIIFSREYASSPWCLDEL VKIVQCMKETGHTVLPIFYDVDPSEVAEQKGQYEKAFVEHEQNFKENLEKVRNWKDCLSTVANLSGWDVRNR

---

DESeq2's median of ratios [POPLAR]

Mapped by: StringTie Salmon Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	NWA:WT	NWB:WT	NWA:OE-ARK2	NWB:OE-ARK2	NWA:miRNA-ARK2	NWB:miRNA-ARK2	NW 0hr	WT H20	WT-NW	TUA1dEY NW	TUA1dEY+TUB15 NW	TUA1dY+TUB9 NW	Pde NW	NWA:WT GA	NWBWT GA	TW:WT	TW:WT GA	NWA:OE-ARK2 GA	NWB:OE-ARK2 GA	TW:OE-ARK2	TW:OE-ARK2 GA	NWA:miRNA-ARK2 GA	NWB:miRNA-ARK2 GA	TW:miRNA-ARK2	TW:miRNA-ARK2 GA	TW 2hr	TW 8hr	TW 24hr	TW 48hr	TW 96hr	TW 336hr	WT ACC	35S::etr1-1 H20	35S::etr1-1 ACC	LMX5::etr1-1 H20	LMX5::etr1-1 ACC	WT-TW	TUA1dEY TW	TUA1dEY+TUB15 TW	TUA1dY+TUB9 TW	Pde TW	OW:WT	OW:WT GA	OW:OE-ARK2	OW:OE-ARK2 GA	OW:miRNA-ARK2	OW:miRNA-ARK2 GA	OW 2hr	OW 8hr	OW 24hr	OW 48hr	OW 96hr	OW 336hr	Root CTR	Root LongCold	Root LongDrougt	Root LongHeat	Root LongSalt	Root ShortCold	Root ShortDrougt	Root ShortHeat	Root ShortSalt	Ptr root	Leaf CTR	Leaf LongCold	Leaf LongDrougt	Leaf LongHeat	Leaf LongSalt	Leaf ShortCold	Leaf ShortDrougt	Leaf ShortHeat	Leaf ShortSalt	Ptr leaf	Stem CTR	Stem LongCold	Stem LongDrougt	Stem LongHeat	Stem LongSalt	Stem ShortCold	Stem ShortDrougt	Stem ShortHeat	Stem ShortSalt	Ptr shoot	Ptr xylem	Ptr phloem	Ptr fiber	Ptr vessel	Ptr fiber vessel ray
AT5G36930			Disease resistance protein (TI...		Potri.017G105501 [exp]	0	1
AT1G03290			unknown protein		Potri.014G139000 [exp]	2.64	0.8869
AT1G70000	MYB		myb-like transcription factor ...		Potri.010G039233 [exp]	3.16	0.8856
					Potri.002G260800 [exp]	13.41	0.8572
AT4G12010			Disease resistance protein (TI...		Potri.017G105201 [exp]	23.10	0.8165
AT3G53560			Tetratricopeptide repeat (TPR)...		Potri.006G213600 [exp]	33.22	0.8629
AT5G53330			Ubiquitin-associated/translati...		Potri.012G033300 [exp]	33.64	0.8797
AT5G13860		ELC-LIKE, ATELC...	ELCH-like (.1)		Potri.001G034200 [exp]	34.38	0.8146
AT1G11050			Protein kinase superfamily pro...		Potri.017G132800 [exp]	37.14	0.8737
AT5G38260			Protein kinase superfamily pro...		Potri.015G045000 [exp]	37.94	0.8439
AT1G69310	WRKY	ATWRKY57, WRKY5...	WRKY DNA-binding protein 57 (....		Potri.008G094000 [exp]	39.47	0.8571

Compare expression of checked genes

Potri.017G105501 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.