Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser] Popgenie AspWood
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT5G24920 48 / 2e-08 ATGDU5 glutamine dumper 5 (.1) AT4G31730 44 / 1e-06 ATGDU1, GDU1 glutamine dumper 1 (.1) AT2G24762 44 / 2e-06 ATGDU4 glutamine dumper 4 (.1) AT4G25760 38 / 0.0001 ATGDU2 glutamine dumper 2 (.1) AT5G57685 38 / 0.0002 LSB1, ATGDU3 LESS SUSCEPTIBLE TO BSCTV 1, ARABIDOPSIS THALIANA GLUTAMINE DUMPER 3, glutamine dumper 3 (.1) AT3G30725 37 / 0.0002 ATGDU6 glutamine dumper 6 (.1) AT5G38770 35 / 0.0008 ATGDU7 glutamine dumper 7 (.1)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.004G108800 [exp] 98 / 3e-28 AT5G24920 57 / 2e-11 glutamine dumper 5 (.1) Potri.017G107400 [exp] 44 / 6e-07 AT4G31730 76 / 1e-18 glutamine dumper 1 (.1) Potri.017G107300 [exp] 44 / 8e-07 AT4G25760 75 / 1e-18 glutamine dumper 2 (.1) Potri.004G108680 [exp] 43 / 1e-06 AT2G24762 63 / 1e-13 glutamine dumper 4 (.1) Potri.018G013600 [exp] 43 / 3e-06 AT4G25760 79 / 2e-19 glutamine dumper 2 (.1) Potri.004G108440 [exp] 41 / 8e-06 AT5G38770 46 / 1e-07 glutamine dumper 7 (.1) Potri.006G173901 [exp] 42 / 9e-06 AT5G57685 89 / 8e-23 LESS SUSCEPTIBLE TO BSCTV 1, ARABIDOPSIS THALIANA GLUTAMINE DUMPER 3, glutamine dumper 3 (.1) Potri.006G267900 [exp] 37 / 0.0003 AT5G57685 83 / 2e-20 LESS SUSCEPTIBLE TO BSCTV 1, ARABIDOPSIS THALIANA GLUTAMINE DUMPER 3, glutamine dumper 3 (.1)
Flax homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10026911 [exp] 40 / 4e-05 AT4G31730 125 / 6e-37 glutamine dumper 1 (.1) Lus10006987 [exp] 38 / 0.0002 AT5G57685 125 / 2e-37 LESS SUSCEPTIBLE TO BSCTV 1, ARABIDOPSIS THALIANA GLUTAMINE DUMPER 3, glutamine dumper 3 (.1) Lus10008910 [exp] 38 / 0.0003 AT5G57685 125 / 6e-37 LESS SUSCEPTIBLE TO BSCTV 1, ARABIDOPSIS THALIANA GLUTAMINE DUMPER 3, glutamine dumper 3 (.1)
PFAM info
Representative CDS sequence Show only first row Show all	>Potri.017G107100.1 pacid=42813802 polypeptide=Potri.017G107100.1.p locus=Potri.017G107100 ID=Potri.017G107100.1.v4.1 annot-version=v4.1 ATGAGGCCTTCAAGTGATTCTACCTCAACCATCAATGTATGGCGTTCTCCAACACCTTACCTGTTTGGCAGCCTAGGCCTGCTGTTAGCAATCATTGCTG TGGCATTGACATCTTTGGCATGTTCTTACTACAGAAACTCATCAGGTGATGAAGAAGAAAAGCCAGCCGCGATGCTCTCAAGCATGCCGGTTCTTCATGC GGAGCCAGAGATTGTTGTCGTCATGGCCGGAGAGGACAAGCCAACGTATCTAGCAACACCATTGTGA
AA sequence Show only first row Show all	>Potri.017G107100.1 pacid=42813802 polypeptide=Potri.017G107100.1.p locus=Potri.017G107100 ID=Potri.017G107100.1.v4.1 annot-version=v4.1 MRPSSDSTSTINVWRSPTPYLFGSLGLLLAIIAVALTSLACSYYRNSSGDEEEKPAAMLSSMPVLHAEPEIVVVMAGEDKPTYLATPL

---

DESeq2's median of ratios [POPLAR]

Mapped by: StringTie Salmon Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	NWA:WT	NWB:WT	NWA:OE-ARK2	NWB:OE-ARK2	NWA:miRNA-ARK2	NWB:miRNA-ARK2	NW 0hr	WT H20	WT-NW	TUA1dEY NW	TUA1dEY+TUB15 NW	TUA1dY+TUB9 NW	Pde NW	NWA:WT GA	NWBWT GA	TW:WT	TW:WT GA	NWA:OE-ARK2 GA	NWB:OE-ARK2 GA	TW:OE-ARK2	TW:OE-ARK2 GA	NWA:miRNA-ARK2 GA	NWB:miRNA-ARK2 GA	TW:miRNA-ARK2	TW:miRNA-ARK2 GA	TW 2hr	TW 8hr	TW 24hr	TW 48hr	TW 96hr	TW 336hr	WT ACC	35S::etr1-1 H20	35S::etr1-1 ACC	LMX5::etr1-1 H20	LMX5::etr1-1 ACC	WT-TW	TUA1dEY TW	TUA1dEY+TUB15 TW	TUA1dY+TUB9 TW	Pde TW	OW:WT	OW:WT GA	OW:OE-ARK2	OW:OE-ARK2 GA	OW:miRNA-ARK2	OW:miRNA-ARK2 GA	OW 2hr	OW 8hr	OW 24hr	OW 48hr	OW 96hr	OW 336hr	Root CTR	Root LongCold	Root LongDrougt	Root LongHeat	Root LongSalt	Root ShortCold	Root ShortDrougt	Root ShortHeat	Root ShortSalt	Ptr root	Leaf CTR	Leaf LongCold	Leaf LongDrougt	Leaf LongHeat	Leaf LongSalt	Leaf ShortCold	Leaf ShortDrougt	Leaf ShortHeat	Leaf ShortSalt	Ptr leaf	Stem CTR	Stem LongCold	Stem LongDrougt	Stem LongHeat	Stem LongSalt	Stem ShortCold	Stem ShortDrougt	Stem ShortHeat	Stem ShortSalt	Ptr shoot	Ptr xylem	Ptr phloem	Ptr fiber	Ptr vessel	Ptr fiber vessel ray
AT5G24920		ATGDU5	glutamine dumper 5 (.1)		Potri.017G107100 [exp]	0	1
					Potri.011G130901 [exp]	6.48	0.7560
AT2G38770		EMB2765	EMBRYO DEFECTIVE 2765, P-loop ...		Potri.001G024401 [exp]	13.26	0.5871
AT5G54470	CO		B-box type zinc finger family ...		Potri.004G027100 [exp]	17.08	0.5231
AT4G22080		RHS14	root hair specific 14 (.1)		Potri.004G007300 [exp]	17.49	0.6417
AT2G22180			hydroxyproline-rich glycoprote...		Potri.005G077100 [exp]	17.97	0.6289
AT5G47670	CCAAT	NF-YB6, L1L	"nuclear factor Y, subunit B6"...		Potri.006G005000 [exp]	18.43	0.6417
					Potri.008G182350 [exp]	19.39	0.5483
AT2G19320			unknown protein		Potri.006G073300 [exp]	26.83	0.5701
AT5G13620			unknown protein		Potri.008G045000 [exp]	27.38	0.6179
AT3G02100			UDP-Glycosyltransferase superf...		Potri.010G084900 [exp]	32.86	0.6113

Compare expression of checked genes

Potri.017G107100 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.