Potri.017G107300 [POPLAR]


External link
JGI Phytozome v13PopgenieAspWood                  
Symbol
Arabidopsis homologues
Locus ID BLAST score/e-value TF class Alias TAIR10 short description
AT4G25760 76 / 1e-18 ATGDU2 glutamine dumper 2 (.1)
AT2G24762 75 / 4e-18 ATGDU4 glutamine dumper 4 (.1)
AT4G31730 73 / 2e-17 ATGDU1, GDU1 glutamine dumper 1 (.1)
AT5G57685 72 / 3e-17 LSB1, ATGDU3 LESS SUSCEPTIBLE TO BSCTV 1, ARABIDOPSIS THALIANA GLUTAMINE DUMPER 3, glutamine dumper 3 (.1)
AT5G38770 61 / 2e-13 ATGDU7 glutamine dumper 7 (.1)
AT5G24920 56 / 4e-11 ATGDU5 glutamine dumper 5 (.1)
AT3G30725 41 / 1e-05 ATGDU6 glutamine dumper 6 (.1)
Paralogs
Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Potri.004G108680 143 / 8e-46 AT2G24762 63 / 1e-13 glutamine dumper 4 (.1)
Potri.017G107200 132 / 3e-41 AT5G57685 63 / 9e-14 LESS SUSCEPTIBLE TO BSCTV 1, ARABIDOPSIS THALIANA GLUTAMINE DUMPER 3, glutamine dumper 3 (.1)
Potri.004G108560 124 / 4e-38 AT4G25760 57 / 2e-11 glutamine dumper 2 (.1)
Potri.017G107400 115 / 8e-35 AT4G31730 76 / 1e-18 glutamine dumper 1 (.1)
Potri.004G108440 88 / 5e-24 AT5G38770 46 / 1e-07 glutamine dumper 7 (.1)
Potri.004G108800 75 / 1e-18 AT5G24920 57 / 2e-11 glutamine dumper 5 (.1)
Potri.018G013600 74 / 1e-17 AT4G25760 79 / 2e-19 glutamine dumper 2 (.1)
Potri.006G173901 74 / 2e-17 AT5G57685 89 / 8e-23 LESS SUSCEPTIBLE TO BSCTV 1, ARABIDOPSIS THALIANA GLUTAMINE DUMPER 3, glutamine dumper 3 (.1)
Potri.006G267900 71 / 1e-16 AT5G57685 83 / 2e-20 LESS SUSCEPTIBLE TO BSCTV 1, ARABIDOPSIS THALIANA GLUTAMINE DUMPER 3, glutamine dumper 3 (.1)
Flax homologues
Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Lus10006986 77 / 6e-19 AT5G57685 124 / 2e-36 LESS SUSCEPTIBLE TO BSCTV 1, ARABIDOPSIS THALIANA GLUTAMINE DUMPER 3, glutamine dumper 3 (.1)
Lus10020107 77 / 8e-19 AT4G31730 122 / 1e-35 glutamine dumper 1 (.1)
Lus10008910 77 / 8e-19 AT5G57685 125 / 6e-37 LESS SUSCEPTIBLE TO BSCTV 1, ARABIDOPSIS THALIANA GLUTAMINE DUMPER 3, glutamine dumper 3 (.1)
Lus10019986 75 / 8e-18 AT5G57685 125 / 7e-37 LESS SUSCEPTIBLE TO BSCTV 1, ARABIDOPSIS THALIANA GLUTAMINE DUMPER 3, glutamine dumper 3 (.1)
Lus10019985 74 / 9e-18 AT5G57685 123 / 3e-36 LESS SUSCEPTIBLE TO BSCTV 1, ARABIDOPSIS THALIANA GLUTAMINE DUMPER 3, glutamine dumper 3 (.1)
Lus10026911 74 / 2e-17 AT4G31730 125 / 6e-37 glutamine dumper 1 (.1)
Lus10015513 73 / 4e-17 AT5G57685 124 / 2e-36 LESS SUSCEPTIBLE TO BSCTV 1, ARABIDOPSIS THALIANA GLUTAMINE DUMPER 3, glutamine dumper 3 (.1)
Lus10006987 69 / 9e-16 AT5G57685 125 / 2e-37 LESS SUSCEPTIBLE TO BSCTV 1, ARABIDOPSIS THALIANA GLUTAMINE DUMPER 3, glutamine dumper 3 (.1)
Lus10008909 57 / 5e-12 AT5G57685 87 / 2e-23 LESS SUSCEPTIBLE TO BSCTV 1, ARABIDOPSIS THALIANA GLUTAMINE DUMPER 3, glutamine dumper 3 (.1)
PFAM info
Representative CDS sequence
>Potri.017G107300.1 pacid=42814051 polypeptide=Potri.017G107300.1.p locus=Potri.017G107300 ID=Potri.017G107300.1.v4.1 annot-version=v4.1
ATGAGGCCAGCAACCAACCCATCAGTAGGAGGTGGCGGTGCTCATGGGGGATTCTGGCATTGGAATTCACCTGTTGCTTACGTCTTTGTTGGTCTAGCAC
TTATGTTGGGGCTTATAACAGTAGCGTTGATAATTCTTGCTTGTTCTTATAGAAAATCTCTGTCCAACTCTTCAAGAAGGGAGGCTGAATTAGATGAAAA
ACCAGCAAAGCAAGTGGAAATACAGGTTGATTTTGAGCCGAAGGTTGTTGTTATCATGGCCGGGGATGAGAATCCTACATACCTGGCAAAGCCTGTTTCT
TGCAACTGCAAAATCGGCGAAAAAGCTTGA
AA sequence
>Potri.017G107300.1 pacid=42814051 polypeptide=Potri.017G107300.1.p locus=Potri.017G107300 ID=Potri.017G107300.1.v4.1 annot-version=v4.1
MRPATNPSVGGGGAHGGFWHWNSPVAYVFVGLALMLGLITVALIILACSYRKSLSNSSRREAELDEKPAKQVEIQVDFEPKVVVIMAGDENPTYLAKPVS
CNCKIGEKA

DESeq2's median of ratios [POPLAR]

Mapped by: Order by: Show schematic diagram

Coexpressed genes

Only top 10 genes are shown Show allDownload tab-delimited text
Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.
At best At TF class At alias At description Locus MR r Symbol NWA:WTNWB:WTNWA:OE-ARK2NWB:OE-ARK2NWA:miRNA-ARK2NWB:miRNA-ARK2NW 0hrWT H20WT-NWTUA1dEY NWTUA1dEY+TUB15 NWTUA1dY+TUB9 NWPde NWNWA:WT GANWBWT GATW:WTTW:WT GANWA:OE-ARK2 GANWB:OE-ARK2 GATW:OE-ARK2TW:OE-ARK2 GANWA:miRNA-ARK2 GANWB:miRNA-ARK2 GATW:miRNA-ARK2TW:miRNA-ARK2 GATW 2hrTW 8hrTW 24hrTW 48hrTW 96hrTW 336hrWT ACC35S::etr1-1 H2035S::etr1-1 ACCLMX5::etr1-1 H20LMX5::etr1-1 ACCWT-TWTUA1dEY TWTUA1dEY+TUB15 TWTUA1dY+TUB9 TWPde TWOW:WTOW:WT GAOW:OE-ARK2OW:OE-ARK2 GAOW:miRNA-ARK2OW:miRNA-ARK2 GAOW 2hrOW 8hrOW 24hrOW 48hrOW 96hrOW 336hrRoot CTRRoot LongColdRoot LongDrougtRoot LongHeatRoot LongSaltRoot ShortColdRoot ShortDrougtRoot ShortHeatRoot ShortSaltPtr rootLeaf CTRLeaf LongColdLeaf LongDrougtLeaf LongHeatLeaf LongSaltLeaf ShortColdLeaf ShortDrougtLeaf ShortHeatLeaf ShortSaltPtr leafStem CTRStem LongColdStem LongDrougtStem LongHeatStem LongSaltStem ShortColdStem ShortDrougtStem ShortHeatStem ShortSaltPtr shootPtr xylemPtr phloemPtr fiberPtr vesselPtr fiber vessel ray
AT4G25760 ATGDU2 glutamine dumper 2 (.1) Potri.017G107300 0 1
AT2G27510 ATFD3 ferredoxin 3 (.1) Potri.004G202500 5.47 0.8796
AT3G09390 ATMT-K, ATMT-1,... ARABIDOPSIS THALIANA METALLOTH... Potri.009G030800 5.47 0.8777
Potri.008G028200 5.65 0.8929
Potri.010G230433 7.93 0.8730
AT3G57710 Protein kinase superfamily pro... Potri.002G004900 9.79 0.8078
AT1G22540 Major facilitator superfamily ... Potri.013G106700 18.00 0.7696
Potri.008G028050 18.65 0.8639
AT5G10770 Eukaryotic aspartyl protease f... Potri.018G014700 18.73 0.8687
AT4G32870 Polyketide cyclase/dehydrase a... Potri.006G237100 18.76 0.8666
Potri.005G000033 20.39 0.8490

Potri.017G107300 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.