Potri.017G107400 [POPLAR]


External link
JGI Phytozome v13PopgenieAspWood                  
Symbol
Arabidopsis homologues
Locus ID BLAST score/e-value TF class Alias TAIR10 short description
AT4G31730 76 / 1e-18 ATGDU1, GDU1 glutamine dumper 1 (.1)
AT2G24762 76 / 2e-18 ATGDU4 glutamine dumper 4 (.1)
AT4G25760 74 / 4e-18 ATGDU2 glutamine dumper 2 (.1)
AT5G57685 67 / 2e-15 LSB1, ATGDU3 LESS SUSCEPTIBLE TO BSCTV 1, ARABIDOPSIS THALIANA GLUTAMINE DUMPER 3, glutamine dumper 3 (.1)
AT5G38770 59 / 9e-13 ATGDU7 glutamine dumper 7 (.1)
AT5G24920 56 / 6e-11 ATGDU5 glutamine dumper 5 (.1)
AT3G30725 41 / 1e-05 ATGDU6 glutamine dumper 6 (.1)
Paralogs
Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Potri.004G108440 148 / 7e-48 AT5G38770 46 / 1e-07 glutamine dumper 7 (.1)
Potri.004G108680 115 / 6e-35 AT2G24762 63 / 1e-13 glutamine dumper 4 (.1)
Potri.017G107300 115 / 9e-35 AT4G25760 75 / 1e-18 glutamine dumper 2 (.1)
Potri.017G107200 101 / 4e-29 AT5G57685 63 / 9e-14 LESS SUSCEPTIBLE TO BSCTV 1, ARABIDOPSIS THALIANA GLUTAMINE DUMPER 3, glutamine dumper 3 (.1)
Potri.004G108560 82 / 8e-22 AT4G25760 57 / 2e-11 glutamine dumper 2 (.1)
Potri.004G108800 79 / 2e-20 AT5G24920 57 / 2e-11 glutamine dumper 5 (.1)
Potri.017G107100 74 / 9e-19 AT5G24920 48 / 2e-08 glutamine dumper 5 (.1)
Potri.018G013600 76 / 2e-18 AT4G25760 79 / 2e-19 glutamine dumper 2 (.1)
Potri.006G173901 73 / 3e-17 AT5G57685 89 / 8e-23 LESS SUSCEPTIBLE TO BSCTV 1, ARABIDOPSIS THALIANA GLUTAMINE DUMPER 3, glutamine dumper 3 (.1)
Flax homologues
Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Lus10020107 79 / 9e-20 AT4G31730 122 / 1e-35 glutamine dumper 1 (.1)
Lus10006986 78 / 4e-19 AT5G57685 124 / 2e-36 LESS SUSCEPTIBLE TO BSCTV 1, ARABIDOPSIS THALIANA GLUTAMINE DUMPER 3, glutamine dumper 3 (.1)
Lus10008910 78 / 5e-19 AT5G57685 125 / 6e-37 LESS SUSCEPTIBLE TO BSCTV 1, ARABIDOPSIS THALIANA GLUTAMINE DUMPER 3, glutamine dumper 3 (.1)
Lus10026911 72 / 5e-17 AT4G31730 125 / 6e-37 glutamine dumper 1 (.1)
Lus10019985 70 / 4e-16 AT5G57685 123 / 3e-36 LESS SUSCEPTIBLE TO BSCTV 1, ARABIDOPSIS THALIANA GLUTAMINE DUMPER 3, glutamine dumper 3 (.1)
Lus10019986 70 / 4e-16 AT5G57685 125 / 7e-37 LESS SUSCEPTIBLE TO BSCTV 1, ARABIDOPSIS THALIANA GLUTAMINE DUMPER 3, glutamine dumper 3 (.1)
Lus10015513 69 / 2e-15 AT5G57685 124 / 2e-36 LESS SUSCEPTIBLE TO BSCTV 1, ARABIDOPSIS THALIANA GLUTAMINE DUMPER 3, glutamine dumper 3 (.1)
Lus10006987 64 / 5e-14 AT5G57685 125 / 2e-37 LESS SUSCEPTIBLE TO BSCTV 1, ARABIDOPSIS THALIANA GLUTAMINE DUMPER 3, glutamine dumper 3 (.1)
Lus10008909 56 / 2e-11 AT5G57685 87 / 2e-23 LESS SUSCEPTIBLE TO BSCTV 1, ARABIDOPSIS THALIANA GLUTAMINE DUMPER 3, glutamine dumper 3 (.1)
PFAM info
Representative CDS sequence
>Potri.017G107400.1 pacid=42813558 polypeptide=Potri.017G107400.1.p locus=Potri.017G107400 ID=Potri.017G107400.1.v4.1 annot-version=v4.1
ATGAGGCCTGCGTTCAACTCTACTGCACCTGCTGTTCATGCAGGATATCAAGATAGGAATTCTCCAATCCCATACCTTTTTTCTAGTATAGGTTTAATGT
TTGGACTTGTTGCAGTGGCATTGATGATTCTAGCTTGCTCCTATAGAAAATCTTCTTCGACTTCGGCTACTGATCCGGAGGTTCAAGAAAAATCTGCTAA
CCAAGTTGAGATGAAAGCAGAAATGGAGCCAAAGATTGTTGTCATCATGGCTGGTGACGATAGGCCTACATATTTGGCCAACCCAGTTTCTTGCAATTGC
CAAAGTGATGAACAAGTTTAA
AA sequence
>Potri.017G107400.1 pacid=42813558 polypeptide=Potri.017G107400.1.p locus=Potri.017G107400 ID=Potri.017G107400.1.v4.1 annot-version=v4.1
MRPAFNSTAPAVHAGYQDRNSPIPYLFSSIGLMFGLVAVALMILACSYRKSSSTSATDPEVQEKSANQVEMKAEMEPKIVVIMAGDDRPTYLANPVSCNC
QSDEQV

DESeq2's median of ratios [POPLAR]

Mapped by: Order by: Show schematic diagram

Coexpressed genes

Only top 10 genes are shown Show allDownload tab-delimited text
Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.
At best At TF class At alias At description Locus MR r Symbol NWA:WTNWB:WTNWA:OE-ARK2NWB:OE-ARK2NWA:miRNA-ARK2NWB:miRNA-ARK2NW 0hrWT H20WT-NWTUA1dEY NWTUA1dEY+TUB15 NWTUA1dY+TUB9 NWPde NWNWA:WT GANWBWT GATW:WTTW:WT GANWA:OE-ARK2 GANWB:OE-ARK2 GATW:OE-ARK2TW:OE-ARK2 GANWA:miRNA-ARK2 GANWB:miRNA-ARK2 GATW:miRNA-ARK2TW:miRNA-ARK2 GATW 2hrTW 8hrTW 24hrTW 48hrTW 96hrTW 336hrWT ACC35S::etr1-1 H2035S::etr1-1 ACCLMX5::etr1-1 H20LMX5::etr1-1 ACCWT-TWTUA1dEY TWTUA1dEY+TUB15 TWTUA1dY+TUB9 TWPde TWOW:WTOW:WT GAOW:OE-ARK2OW:OE-ARK2 GAOW:miRNA-ARK2OW:miRNA-ARK2 GAOW 2hrOW 8hrOW 24hrOW 48hrOW 96hrOW 336hrRoot CTRRoot LongColdRoot LongDrougtRoot LongHeatRoot LongSaltRoot ShortColdRoot ShortDrougtRoot ShortHeatRoot ShortSaltPtr rootLeaf CTRLeaf LongColdLeaf LongDrougtLeaf LongHeatLeaf LongSaltLeaf ShortColdLeaf ShortDrougtLeaf ShortHeatLeaf ShortSaltPtr leafStem CTRStem LongColdStem LongDrougtStem LongHeatStem LongSaltStem ShortColdStem ShortDrougtStem ShortHeatStem ShortSaltPtr shootPtr xylemPtr phloemPtr fiberPtr vesselPtr fiber vessel ray
AT4G31730 ATGDU1, GDU1 glutamine dumper 1 (.1) Potri.017G107400 0 1
Potri.014G065300 10.81 0.8826
AT1G54870 NAD(P)-binding Rossmann-fold s... Potri.013G023900 15.00 0.8113
AT5G36930 Disease resistance protein (TI... Potri.006G269950 17.32 0.8688
AT3G25400 unknown protein Potri.008G168700 18.54 0.8069
AT5G57150 bHLH bHLH035 basic helix-loop-helix (bHLH) ... Potri.006G074600 23.74 0.7511
Potri.003G195000 28.63 0.8091
AT4G30130 Protein of unknown function (D... Potri.018G147749 28.98 0.8571
AT3G55870 ADC synthase superfamily prote... Potri.008G066600 33.98 0.8567 Pt-ASA1.1,ASA%2C,pseudogene
AT1G13195 RING/U-box superfamily protein... Potri.010G053000 34.49 0.8075
Potri.012G007445 39.91 0.8487

Potri.017G107400 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.