Potri.017G107900 [POPLAR]


External link
JGI Phytozome v13PopgenieAspWood                  
Symbol
Arabidopsis homologues
Locus ID BLAST score/e-value TF class Alias TAIR10 short description
AT1G33390 100 / 9e-26 ATFAS4 FASCIATED STEM 4, RNA helicase family protein (.1)
Paralogs
Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Potri.002G201400 148 / 9e-43 AT1G33390 1056 / 0.0 FASCIATED STEM 4, RNA helicase family protein (.1)
Flax homologues
Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Lus10025616 119 / 3e-32 AT1G33390 1175 / 0.0 FASCIATED STEM 4, RNA helicase family protein (.1)
Lus10028066 117 / 2e-31 AT1G33390 1148 / 0.0 FASCIATED STEM 4, RNA helicase family protein (.1)
PFAM info
Clan ID Clan name Pfam ID Pfam name Pfam description
CL0021 OB PF07717 OB_NTP_bind Oligonucleotide/oligosaccharide-binding (OB)-fold
Representative CDS sequence
>Potri.017G107900.1 pacid=42813246 polypeptide=Potri.017G107900.1.p locus=Potri.017G107900 ID=Potri.017G107900.1.v4.1 annot-version=v4.1
ATGGAAGGACATAGGAAAGCAAAGGCAGTTCGGTATCAAGCTTGCATGGTTGATGAAATTGTATTTCTCAACCGTCGGTCCTCTCTTTATCATGCAGCTC
CTGAGTTTTTAGTGTACTCTGAATTGCTGCATACAAAATGGCCATACATTCATGGACCAAAAAGCGTGAAACCTGAATGGCTTGCCAATTATGGCGAGTC
TTCGTGTGATTTTTCTGAAGTAGAACACCATAAACCTTTTTATCATCCTGAAACTGACCAAGCATTTCATGCGATTGTTCCATTTTTTACGCTTCATCTG
TGGGAGCTTCTGCAATGTTATTTGCCATTTAAAAGGTGA
AA sequence
>Potri.017G107900.1 pacid=42813246 polypeptide=Potri.017G107900.1.p locus=Potri.017G107900 ID=Potri.017G107900.1.v4.1 annot-version=v4.1
MEGHRKAKAVRYQACMVDEIVFLNRRSSLYHAAPEFLVYSELLHTKWPYIHGPKSVKPEWLANYGESSCDFSEVEHHKPFYHPETDQAFHAIVPFFTLHL
WELLQCYLPFKR

DESeq2's median of ratios [POPLAR]

Mapped by: Order by: Show schematic diagram

Coexpressed genes

Only top 10 genes are shown Show allDownload tab-delimited text
Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.
At best At TF class At alias At description Locus MR r Symbol NWA:WTNWB:WTNWA:OE-ARK2NWB:OE-ARK2NWA:miRNA-ARK2NWB:miRNA-ARK2NW 0hrWT H20WT-NWTUA1dEY NWTUA1dEY+TUB15 NWTUA1dY+TUB9 NWPde NWNWA:WT GANWBWT GATW:WTTW:WT GANWA:OE-ARK2 GANWB:OE-ARK2 GATW:OE-ARK2TW:OE-ARK2 GANWA:miRNA-ARK2 GANWB:miRNA-ARK2 GATW:miRNA-ARK2TW:miRNA-ARK2 GATW 2hrTW 8hrTW 24hrTW 48hrTW 96hrTW 336hrWT ACC35S::etr1-1 H2035S::etr1-1 ACCLMX5::etr1-1 H20LMX5::etr1-1 ACCWT-TWTUA1dEY TWTUA1dEY+TUB15 TWTUA1dY+TUB9 TWPde TWOW:WTOW:WT GAOW:OE-ARK2OW:OE-ARK2 GAOW:miRNA-ARK2OW:miRNA-ARK2 GAOW 2hrOW 8hrOW 24hrOW 48hrOW 96hrOW 336hrRoot CTRRoot LongColdRoot LongDrougtRoot LongHeatRoot LongSaltRoot ShortColdRoot ShortDrougtRoot ShortHeatRoot ShortSaltPtr rootLeaf CTRLeaf LongColdLeaf LongDrougtLeaf LongHeatLeaf LongSaltLeaf ShortColdLeaf ShortDrougtLeaf ShortHeatLeaf ShortSaltPtr leafStem CTRStem LongColdStem LongDrougtStem LongHeatStem LongSaltStem ShortColdStem ShortDrougtStem ShortHeatStem ShortSaltPtr shootPtr xylemPtr phloemPtr fiberPtr vesselPtr fiber vessel ray
AT1G33390 ATFAS4 FASCIATED STEM 4, RNA helicase... Potri.017G107900 0 1
AT4G02510 TOC86, TOC160, ... TRANSLOCON AT THE OUTER ENVELO... Potri.010G014300 17.60 0.7977
AT4G03030 Galactose oxidase/kelch repeat... Potri.005G221300 22.18 0.7944
AT5G09995 unknown protein Potri.007G081800 23.74 0.7771
AT1G65520 PEC11, ECHIC, A... "delta\(3\), delta\(2\)-enoyl ... Potri.008G052801 29.24 0.7716
AT2G36740 ATSWC2 sequence-specific DNA binding ... Potri.001G412800 37.34 0.7070
Potri.014G022050 42.07 0.7249
AT3G10870 ATMES17, MES17 ARABIDOPSIS THALIANA METHYL ES... Potri.013G158200 48.06 0.7622
AT1G17370 UBP1B oligouridylate binding protein... Potri.003G069000 64.48 0.7148
AT2G23540 GDSL-like Lipase/Acylhydrolase... Potri.008G216400 69.59 0.7462
AT5G62810 ATPEX14, PED2, ... PEROXISOME DEFECTIVE 2, peroxi... Potri.012G080800 70.71 0.7535

Potri.017G107900 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.