Potri.017G108400 [POPLAR]


External link
JGI Phytozome v13PopgenieAspWood                  
Symbol
Arabidopsis homologues
Locus ID BLAST score/e-value TF class Alias TAIR10 short description
AT5G38760 97 / 1e-28 Late embryogenesis abundant protein (LEA) family protein (.1)
AT5G53820 86 / 3e-24 Late embryogenesis abundant protein (LEA) family protein (.1)
AT3G02480 55 / 5e-12 Late embryogenesis abundant protein (LEA) family protein (.1)
AT5G15970 37 / 0.0001 AtCor6.6, COR6.6, KIN2 COLD-RESPONSIVE 6.6, stress-responsive protein (KIN2) / stress-induced protein (KIN2) / cold-responsive protein (COR6.6) / cold-regulated protein (COR6.6) (.1)
AT5G15960 35 / 0.0005 KIN1 stress-responsive protein (KIN1) / stress-induced protein (KIN1) (.1)
Paralogs
Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Potri.017G108300 127 / 1e-40 AT5G38760 96 / 3e-28 Late embryogenesis abundant protein (LEA) family protein (.1)
Potri.017G108350 127 / 1e-40 AT5G38760 96 / 3e-28 Late embryogenesis abundant protein (LEA) family protein (.1)
Potri.004G107800 113 / 3e-35 AT5G38760 98 / 5e-29 Late embryogenesis abundant protein (LEA) family protein (.1)
Potri.004G107900 113 / 3e-35 AT5G38760 98 / 5e-29 Late embryogenesis abundant protein (LEA) family protein (.1)
Potri.004G107100 113 / 3e-35 AT5G38760 98 / 5e-29 Late embryogenesis abundant protein (LEA) family protein (.1)
Potri.004G107500 113 / 5e-35 AT5G38760 97 / 1e-28 Late embryogenesis abundant protein (LEA) family protein (.1)
Potri.004G107600 109 / 1e-33 AT5G38760 90 / 8e-26 Late embryogenesis abundant protein (LEA) family protein (.1)
Potri.017G108500 99 / 4e-29 AT5G38760 56 / 9e-12 Late embryogenesis abundant protein (LEA) family protein (.1)
Potri.004G107700 84 / 1e-23 AT5G53820 75 / 6e-20 Late embryogenesis abundant protein (LEA) family protein (.1)
Flax homologues
Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Lus10034100 90 / 1e-25 AT5G38760 89 / 2e-25 Late embryogenesis abundant protein (LEA) family protein (.1)
Lus10003046 77 / 6e-21 AT5G38760 82 / 1e-22 Late embryogenesis abundant protein (LEA) family protein (.1)
Lus10034081 77 / 1e-20 AT5G38760 80 / 9e-22 Late embryogenesis abundant protein (LEA) family protein (.1)
Lus10010451 77 / 1e-20 AT5G38760 83 / 3e-23 Late embryogenesis abundant protein (LEA) family protein (.1)
Lus10027298 75 / 7e-20 AT5G53820 81 / 4e-22 Late embryogenesis abundant protein (LEA) family protein (.1)
Lus10003056 74 / 2e-19 AT5G53820 74 / 2e-19 Late embryogenesis abundant protein (LEA) family protein (.1)
Lus10039004 72 / 1e-18 AT5G53820 78 / 5e-21 Late embryogenesis abundant protein (LEA) family protein (.1)
Lus10007566 72 / 2e-18 AT5G53820 80 / 8e-22 Late embryogenesis abundant protein (LEA) family protein (.1)
Lus10012179 70 / 1e-17 AT5G38760 74 / 2e-19 Late embryogenesis abundant protein (LEA) family protein (.1)
Lus10026292 57 / 5e-13 AT5G38760 65 / 4e-16 Late embryogenesis abundant protein (LEA) family protein (.1)
PFAM info
Representative CDS sequence
>Potri.017G108400.1 pacid=42813696 polypeptide=Potri.017G108400.1.p locus=Potri.017G108400 ID=Potri.017G108400.1.v4.1 annot-version=v4.1
ATGGCTGACAATACCCAGAAGATGAGCTTCCAAGCTGGTGAGGCCAAGGGCCAAGTTCAGGAGAAGGCCAGTACCTTGATGGACAGAGCTGGTAATGCTG
CTCAATCTGCAAAGGAATCAGTGCAAGAGGCTGGTCAACAGGTGATGTCTACGGCACAGGGAGCTGTTGAAGGAGTGAAGAATGCAACTGGAATGAACAA
ATGA
AA sequence
>Potri.017G108400.1 pacid=42813696 polypeptide=Potri.017G108400.1.p locus=Potri.017G108400 ID=Potri.017G108400.1.v4.1 annot-version=v4.1
MADNTQKMSFQAGEAKGQVQEKASTLMDRAGNAAQSAKESVQEAGQQVMSTAQGAVEGVKNATGMNK

DESeq2's median of ratios [POPLAR]

Mapped by: Order by: Show schematic diagram

Coexpressed genes

Only top 10 genes are shown Show allDownload tab-delimited text
Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.
At best At TF class At alias At description Locus MR r Symbol NWA:WTNWB:WTNWA:OE-ARK2NWB:OE-ARK2NWA:miRNA-ARK2NWB:miRNA-ARK2NW 0hrWT H20WT-NWTUA1dEY NWTUA1dEY+TUB15 NWTUA1dY+TUB9 NWPde NWNWA:WT GANWBWT GATW:WTTW:WT GANWA:OE-ARK2 GANWB:OE-ARK2 GATW:OE-ARK2TW:OE-ARK2 GANWA:miRNA-ARK2 GANWB:miRNA-ARK2 GATW:miRNA-ARK2TW:miRNA-ARK2 GATW 2hrTW 8hrTW 24hrTW 48hrTW 96hrTW 336hrWT ACC35S::etr1-1 H2035S::etr1-1 ACCLMX5::etr1-1 H20LMX5::etr1-1 ACCWT-TWTUA1dEY TWTUA1dEY+TUB15 TWTUA1dY+TUB9 TWPde TWOW:WTOW:WT GAOW:OE-ARK2OW:OE-ARK2 GAOW:miRNA-ARK2OW:miRNA-ARK2 GAOW 2hrOW 8hrOW 24hrOW 48hrOW 96hrOW 336hrRoot CTRRoot LongColdRoot LongDrougtRoot LongHeatRoot LongSaltRoot ShortColdRoot ShortDrougtRoot ShortHeatRoot ShortSaltPtr rootLeaf CTRLeaf LongColdLeaf LongDrougtLeaf LongHeatLeaf LongSaltLeaf ShortColdLeaf ShortDrougtLeaf ShortHeatLeaf ShortSaltPtr leafStem CTRStem LongColdStem LongDrougtStem LongHeatStem LongSaltStem ShortColdStem ShortDrougtStem ShortHeatStem ShortSaltPtr shootPtr xylemPtr phloemPtr fiberPtr vesselPtr fiber vessel ray
AT5G38760 Late embryogenesis abundant pr... Potri.017G108400 0 1
AT5G38760 Late embryogenesis abundant pr... Potri.017G108350 1.00 0.9429
AT4G16146 cAMP-regulated phosphoprotein ... Potri.010G141300 1.41 0.7927
AT5G67380 ATCKA1, CKA1 casein kinase alpha 1 (.1.2) Potri.005G145900 4.00 0.6819 Pt-CKA1.2
AT4G21020 Late embryogenesis abundant pr... Potri.004G046000 5.65 0.7419 Pt-PM32.1
AT5G38760 Late embryogenesis abundant pr... Potri.017G108300 7.14 0.7860
AT1G15460 ATBOR4 ARABIDOPSIS THALIANA REQUIRES ... Potri.001G174500 18.16 0.7257
AT5G26594 ARR24 response regulator 24 (.1) Potri.002G253000 25.09 0.6889
AT1G21200 Trihelix sequence-specific DNA binding ... Potri.003G204700 27.38 0.6641
AT2G41290 SSL2 strictosidine synthase-like 2 ... Potri.006G040900 28.63 0.6702
AT5G27930 Protein phosphatase 2C family ... Potri.013G012200 33.43 0.6319

Potri.017G108400 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.