Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser] Popgenie AspWood
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT3G19660 50 / 4e-10 unknown protein
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.004G105900 [exp] 108 / 3e-33 AT3G19660 46 / 2e-08 unknown protein Potri.017G109900 [exp] 105 / 4e-32 AT3G19660 49 / 1e-09 unknown protein Potri.004G105800 [exp] 74 / 4e-19 AT3G19660 41 / 3e-06 unknown protein Potri.001G290200 [exp] 62 / 6e-15 AT3G19660 71 / 2e-18 unknown protein Potri.009G085800 [exp] 57 / 9e-13 AT3G19660 64 / 2e-15 unknown protein
Flax homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10033765 [exp] 56 / 4e-12 AT3G19660 82 / 1e-22 unknown protein Lus10012438 [exp] 54 / 1e-11 AT3G19660 84 / 1e-23 unknown protein
PFAM info
Representative CDS sequence Show only first row Show all	>Potri.017G109800.3 pacid=42814438 polypeptide=Potri.017G109800.3.p locus=Potri.017G109800 ID=Potri.017G109800.3.v4.1 annot-version=v4.1 ATGGTGATGATGGGACTAGAGAGGTTGATGGTGTTCTTGAAATCCAGAATGAGGTTCTTGAAGATGAAGAAACCTTATGATAAGATTGAGAAGAGTGAGA GCATGAGAGTTGAAATAAGAAGCAGGAAGGCCAGGAAGCTCGTTGAAGAGACATTGAAGATCGCTGATTCTCCAAAGACCAAGACGTATGCTTTCTGA
AA sequence Show only first row Show all	>Potri.017G109800.3 pacid=42814438 polypeptide=Potri.017G109800.3.p locus=Potri.017G109800 ID=Potri.017G109800.3.v4.1 annot-version=v4.1 MVMMGLERLMVFLKSRMRFLKMKKPYDKIEKSESMRVEIRSRKARKLVEETLKIADSPKTKTYAF

---

DESeq2's median of ratios [POPLAR]

Mapped by: StringTie Salmon Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	NWA:WT	NWB:WT	NWA:OE-ARK2	NWB:OE-ARK2	NWA:miRNA-ARK2	NWB:miRNA-ARK2	NW 0hr	WT H20	WT-NW	TUA1dEY NW	TUA1dEY+TUB15 NW	TUA1dY+TUB9 NW	Pde NW	NWA:WT GA	NWBWT GA	TW:WT	TW:WT GA	NWA:OE-ARK2 GA	NWB:OE-ARK2 GA	TW:OE-ARK2	TW:OE-ARK2 GA	NWA:miRNA-ARK2 GA	NWB:miRNA-ARK2 GA	TW:miRNA-ARK2	TW:miRNA-ARK2 GA	TW 2hr	TW 8hr	TW 24hr	TW 48hr	TW 96hr	TW 336hr	WT ACC	35S::etr1-1 H20	35S::etr1-1 ACC	LMX5::etr1-1 H20	LMX5::etr1-1 ACC	WT-TW	TUA1dEY TW	TUA1dEY+TUB15 TW	TUA1dY+TUB9 TW	Pde TW	OW:WT	OW:WT GA	OW:OE-ARK2	OW:OE-ARK2 GA	OW:miRNA-ARK2	OW:miRNA-ARK2 GA	OW 2hr	OW 8hr	OW 24hr	OW 48hr	OW 96hr	OW 336hr	Root CTR	Root LongCold	Root LongDrougt	Root LongHeat	Root LongSalt	Root ShortCold	Root ShortDrougt	Root ShortHeat	Root ShortSalt	Ptr root	Leaf CTR	Leaf LongCold	Leaf LongDrougt	Leaf LongHeat	Leaf LongSalt	Leaf ShortCold	Leaf ShortDrougt	Leaf ShortHeat	Leaf ShortSalt	Ptr leaf	Stem CTR	Stem LongCold	Stem LongDrougt	Stem LongHeat	Stem LongSalt	Stem ShortCold	Stem ShortDrougt	Stem ShortHeat	Stem ShortSalt	Ptr shoot	Ptr xylem	Ptr phloem	Ptr fiber	Ptr vessel	Ptr fiber vessel ray
AT3G19660			unknown protein		Potri.017G109800 [exp]	0	1
AT3G21750		UGT71B1	UDP-glucosyl transferase 71B1 ...		Potri.016G016000 [exp]	6.63	0.9582
AT1G52827		ATCDT1	cadmium tolerance 1 (.1)		Potri.001G177366 [exp]	8.48	0.9438
AT3G03620			MATE efflux family protein (.1...		Potri.013G069600 [exp]	9.21	0.9313
AT5G52420			unknown protein		Potri.015G146400 [exp]	11.22	0.9457
AT3G14420			Aldolase-type TIM barrel famil...		Potri.011G112700 [exp]	11.74	0.9476
AT4G39250	MYB	RSM2, ATRL1	RADIALIS-LIKE SANT/MYB 2, RAD-...		Potri.009G117200 [exp]	12.00	0.9338
AT1G29070			Ribosomal protein L34 (.1)		Potri.011G064800 [exp]	20.85	0.9448
AT5G02120		PDE335, OHP	PIGMENT DEFECTIVE 335, one hel...		Potri.006G088200 [exp]	24.55	0.9365
AT3G26650		GAPA-1, GAPA	GLYCERALDEHYDE 3-PHOSPHATE DEH...		Potri.002G220566 [exp]	26.85	0.9430
AT1G42550		PMI1	plastid movement impaired1 (.1...		Potri.005G255500 [exp]	31.93	0.9328

Compare expression of checked genes

Potri.017G109800 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.