Potri.017G111700 [POPLAR]


External link
JGI Phytozome v13PopgenieAspWood                  
Symbol
Arabidopsis homologues
Locus ID BLAST score/e-value TF class Alias TAIR10 short description
AT5G38630 321 / 4e-112 ACYB-1 cytochrome B561-1 (.1)
AT4G25570 187 / 2e-59 ACYB-2 Cytochrome b561/ferric reductase transmembrane protein family (.1)
AT1G26100 166 / 5e-51 Cytochrome b561/ferric reductase transmembrane protein family (.1)
AT1G14730 124 / 4e-35 Cytochrome b561/ferric reductase transmembrane protein family (.1)
Paralogs
Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Potri.004G103800 397 / 2e-142 AT5G38630 301 / 2e-104 cytochrome B561-1 (.1)
Potri.008G115300 308 / 6e-107 AT5G38630 272 / 7e-93 cytochrome B561-1 (.1)
Potri.012G141000 192 / 1e-61 AT4G25570 254 / 5e-86 Cytochrome b561/ferric reductase transmembrane protein family (.1)
Potri.015G143700 192 / 2e-61 AT4G25570 297 / 8e-103 Cytochrome b561/ferric reductase transmembrane protein family (.1)
Potri.010G131100 179 / 3e-56 AT1G26100 270 / 6e-92 Cytochrome b561/ferric reductase transmembrane protein family (.1)
Potri.008G115200 179 / 3e-56 AT1G26100 270 / 6e-92 Cytochrome b561/ferric reductase transmembrane protein family (.1)
Potri.008G138300 159 / 9e-49 AT1G14730 252 / 2e-85 Cytochrome b561/ferric reductase transmembrane protein family (.1)
Potri.010G102400 157 / 6e-48 AT1G14730 271 / 7e-93 Cytochrome b561/ferric reductase transmembrane protein family (.1)
Flax homologues
Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Lus10003076 310 / 9e-109 AT5G38630 281 / 2e-97 cytochrome B561-1 (.1)
Lus10034074 293 / 4e-100 AT5G38630 287 / 7e-98 cytochrome B561-1 (.1)
Lus10039216 205 / 2e-66 AT4G25570 305 / 6e-106 Cytochrome b561/ferric reductase transmembrane protein family (.1)
Lus10038866 200 / 2e-64 AT4G25570 326 / 3e-114 Cytochrome b561/ferric reductase transmembrane protein family (.1)
Lus10014986 201 / 9e-64 AT4G25570 331 / 8e-115 Cytochrome b561/ferric reductase transmembrane protein family (.1)
Lus10027461 189 / 1e-59 AT4G25570 287 / 3e-98 Cytochrome b561/ferric reductase transmembrane protein family (.1)
Lus10021715 164 / 5e-50 AT1G26100 241 / 3e-80 Cytochrome b561/ferric reductase transmembrane protein family (.1)
Lus10034427 137 / 7e-40 AT1G14730 280 / 4e-96 Cytochrome b561/ferric reductase transmembrane protein family (.1)
Lus10031935 133 / 2e-38 AT1G14730 284 / 8e-98 Cytochrome b561/ferric reductase transmembrane protein family (.1)
Lus10035096 111 / 8e-28 AT2G02010 835 / 0.0 glutamate decarboxylase 4 (.1)
PFAM info
Clan ID Clan name Pfam ID Pfam name Pfam description
CL0328 2heme_cytochrom PF03188 Cytochrom_B561 Eukaryotic cytochrome b561
Representative CDS sequence
>Potri.017G111700.1 pacid=42813731 polypeptide=Potri.017G111700.1.p locus=Potri.017G111700 ID=Potri.017G111700.1.v4.1 annot-version=v4.1
ATGGCAGTTCCAGTGATTAAATTCCCAACCTTGATGAGGTTGATTAGGTTAATGGGGGTGTTAGTAACTGCTTTAGTGTTGACATGGACTGTTCATTACA
GAGGAGGACTAGCTCTTGTCTCTGCTAACAAAGATCTCATCTTCAATGCACACCCTGTTTTAATGGTGATTGGGCTTGTACTCGTGAATGGTGAAGCCAT
GCTAGCCTACAAAACGGTGCCAGGAACAAAAAGCTTCAAAAAATTAGTTCATCTGACACTACAATTCCTCGCATTTTGTTTAAGCTTGATTGGCTTTTGG
GCTGCTTTGAAATTCCACAATGACAAAGGCATTGACAATTTTTACAGCCTGCATTCTTGGCTGGGACTAGCTTGCCTTTTCCTCTTCAGCATCCAGTGGG
CTTCTGGGTTTGTAACCTTTTGGTATCCAGGAGGTTCAAGAAACAGCAGGGCCACCTTGCTTCCATGGCATGTGTTCTCTGGGGTTTATATTTATGCCCT
ATCTGTTGCCACTGCTACTACTGGTATCTTAGAAAAAGTCACTTTCCTCCAAACCAACAACGTGATATCACGCTACTCCACTGAAGCTTTGCTGGTGAAC
TCATTGGGTATCTTGATGATTGTTCTGGGTGGTTTCGTTGTTCTTGCATCAGTTTCTTCTCTGAATAGCAAAGGCGACATCCCTAGAAATGCAACAGAGT
AG
AA sequence
>Potri.017G111700.1 pacid=42813731 polypeptide=Potri.017G111700.1.p locus=Potri.017G111700 ID=Potri.017G111700.1.v4.1 annot-version=v4.1
MAVPVIKFPTLMRLIRLMGVLVTALVLTWTVHYRGGLALVSANKDLIFNAHPVLMVIGLVLVNGEAMLAYKTVPGTKSFKKLVHLTLQFLAFCLSLIGFW
AALKFHNDKGIDNFYSLHSWLGLACLFLFSIQWASGFVTFWYPGGSRNSRATLLPWHVFSGVYIYALSVATATTGILEKVTFLQTNNVISRYSTEALLVN
SLGILMIVLGGFVVLASVSSLNSKGDIPRNATE

DESeq2's median of ratios [POPLAR]

Mapped by: Order by: Show schematic diagram

Coexpressed genes

Only top 10 genes are shown Show allDownload tab-delimited text
Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.
At best At TF class At alias At description Locus MR r Symbol NWA:WTNWB:WTNWA:OE-ARK2NWB:OE-ARK2NWA:miRNA-ARK2NWB:miRNA-ARK2NW 0hrWT H20WT-NWTUA1dEY NWTUA1dEY+TUB15 NWTUA1dY+TUB9 NWPde NWNWA:WT GANWBWT GATW:WTTW:WT GANWA:OE-ARK2 GANWB:OE-ARK2 GATW:OE-ARK2TW:OE-ARK2 GANWA:miRNA-ARK2 GANWB:miRNA-ARK2 GATW:miRNA-ARK2TW:miRNA-ARK2 GATW 2hrTW 8hrTW 24hrTW 48hrTW 96hrTW 336hrWT ACC35S::etr1-1 H2035S::etr1-1 ACCLMX5::etr1-1 H20LMX5::etr1-1 ACCWT-TWTUA1dEY TWTUA1dEY+TUB15 TWTUA1dY+TUB9 TWPde TWOW:WTOW:WT GAOW:OE-ARK2OW:OE-ARK2 GAOW:miRNA-ARK2OW:miRNA-ARK2 GAOW 2hrOW 8hrOW 24hrOW 48hrOW 96hrOW 336hrRoot CTRRoot LongColdRoot LongDrougtRoot LongHeatRoot LongSaltRoot ShortColdRoot ShortDrougtRoot ShortHeatRoot ShortSaltPtr rootLeaf CTRLeaf LongColdLeaf LongDrougtLeaf LongHeatLeaf LongSaltLeaf ShortColdLeaf ShortDrougtLeaf ShortHeatLeaf ShortSaltPtr leafStem CTRStem LongColdStem LongDrougtStem LongHeatStem LongSaltStem ShortColdStem ShortDrougtStem ShortHeatStem ShortSaltPtr shootPtr xylemPtr phloemPtr fiberPtr vesselPtr fiber vessel ray
AT5G38630 ACYB-1 cytochrome B561-1 (.1) Potri.017G111700 0 1
AT3G16240 DELTA-TIP1, ATT... delta tonoplast integral prote... Potri.003G050900 1.00 0.8669 Pt-TIP2.3
AT2G45340 Leucine-rich repeat protein ki... Potri.014G068700 5.29 0.8596
AT5G56230 PRA1.G2 prenylated RAB acceptor 1.G2 (... Potri.001G472300 7.21 0.8145
AT5G19630 alpha/beta-Hydrolases superfam... Potri.003G212400 8.36 0.8294
AT4G36760 ATAPP1 ARABIDOPSIS THALIANA AMINOPEPT... Potri.018G145576 8.77 0.8350
AT1G74520 ATHVA22A HVA22 homologue A (.1) Potri.015G062800 8.94 0.8479
AT4G30996 NKS1 NA\(+\)- AND K\(+\)-SENSITIVE ... Potri.006G187800 9.16 0.7734
AT1G13380 Protein of unknown function (D... Potri.008G120900 9.79 0.8339
AT5G20590 TBL5 TRICHOME BIREFRINGENCE-LIKE 5 ... Potri.006G071500 11.74 0.8012
AT3G58170 ATBET11, ATBS14... ARABIDOPSIS THALIANA BET1P/SFT... Potri.002G041500 12.48 0.8433 Pt-BET11.2

Potri.017G111700 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.