Potri.017G111900 [POPLAR]


External link
JGI Phytozome v13PopgenieAspWood                  
Symbol
Arabidopsis homologues
Locus ID BLAST score/e-value TF class Alias TAIR10 short description
AT1G67250 188 / 2e-62 Proteasome maturation factor UMP1 (.1)
AT5G38650 188 / 2e-62 Proteasome maturation factor UMP1 (.1)
AT5G38660 189 / 3e-59 APE1 acclimation of photosynthesis to environment (.1.2)
AT1G62920 0 / 1 unknown protein
Paralogs
Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Potri.006G249600 265 / 9e-93 AT1G67250 186 / 7e-62 Proteasome maturation factor UMP1 (.1)
Flax homologues
Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Lus10034073 185 / 3e-61 AT5G38660 197 / 3e-66 acclimation of photosynthesis to environment (.1.2)
Lus10003077 184 / 6e-61 AT5G38660 193 / 1e-64 acclimation of photosynthesis to environment (.1.2)
Lus10005377 53 / 9e-10 AT5G38650 54 / 2e-10 Proteasome maturation factor UMP1 (.1)
PFAM info
Clan ID Clan name Pfam ID Pfam name Pfam description
PF05348 UMP1 Proteasome maturation factor UMP1
Representative CDS sequence
>Potri.017G111900.2 pacid=42813362 polypeptide=Potri.017G111900.2.p locus=Potri.017G111900 ID=Potri.017G111900.2.v4.1 annot-version=v4.1
ATGGAAGCACCAAAGATGATCGAGCATCAAATTGGAGACATCCATGATGCTCTTCGGTTCGGCCTCGATACCAAGAGAGGCGACATCATTGGATCTCACC
CTCTTGAATCTGCCTTGCTCTCTGTGGAGAGAAATCAAGAGCATATGAAGAGAATAACACTTGCGAACGTTTATGGAGCAGCCTTTCCCGTTCAGATGGG
CATCGAAAGGCAGATGCTTTCTAGATTCCAGAGGCCACAAGGACCAATTCCATCTTCAATGCTAGGACTAGAGGCTTTGACAGGAAGTTTGGAGGATTTT
GGTTTCGAGGATTATCTGAATGATCCTCGTGAGTCTGAAACTTTCCGTCCAGTGGACATGCACAGTGGGATGGAAGTTCGTCTTGGATTGTCTAAAGGGC
CAGCCTGCAAAAGCTTCATGTGA
AA sequence
>Potri.017G111900.2 pacid=42813362 polypeptide=Potri.017G111900.2.p locus=Potri.017G111900 ID=Potri.017G111900.2.v4.1 annot-version=v4.1
MEAPKMIEHQIGDIHDALRFGLDTKRGDIIGSHPLESALLSVERNQEHMKRITLANVYGAAFPVQMGIERQMLSRFQRPQGPIPSSMLGLEALTGSLEDF
GFEDYLNDPRESETFRPVDMHSGMEVRLGLSKGPACKSFM

DESeq2's median of ratios [POPLAR]

Mapped by: Order by: Show schematic diagram

Coexpressed genes

Only top 10 genes are shown Show allDownload tab-delimited text
Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.
At best At TF class At alias At description Locus MR r Symbol NWA:WTNWB:WTNWA:OE-ARK2NWB:OE-ARK2NWA:miRNA-ARK2NWB:miRNA-ARK2NW 0hrWT H20WT-NWTUA1dEY NWTUA1dEY+TUB15 NWTUA1dY+TUB9 NWPde NWNWA:WT GANWBWT GATW:WTTW:WT GANWA:OE-ARK2 GANWB:OE-ARK2 GATW:OE-ARK2TW:OE-ARK2 GANWA:miRNA-ARK2 GANWB:miRNA-ARK2 GATW:miRNA-ARK2TW:miRNA-ARK2 GATW 2hrTW 8hrTW 24hrTW 48hrTW 96hrTW 336hrWT ACC35S::etr1-1 H2035S::etr1-1 ACCLMX5::etr1-1 H20LMX5::etr1-1 ACCWT-TWTUA1dEY TWTUA1dEY+TUB15 TWTUA1dY+TUB9 TWPde TWOW:WTOW:WT GAOW:OE-ARK2OW:OE-ARK2 GAOW:miRNA-ARK2OW:miRNA-ARK2 GAOW 2hrOW 8hrOW 24hrOW 48hrOW 96hrOW 336hrRoot CTRRoot LongColdRoot LongDrougtRoot LongHeatRoot LongSaltRoot ShortColdRoot ShortDrougtRoot ShortHeatRoot ShortSaltPtr rootLeaf CTRLeaf LongColdLeaf LongDrougtLeaf LongHeatLeaf LongSaltLeaf ShortColdLeaf ShortDrougtLeaf ShortHeatLeaf ShortSaltPtr leafStem CTRStem LongColdStem LongDrougtStem LongHeatStem LongSaltStem ShortColdStem ShortDrougtStem ShortHeatStem ShortSaltPtr shootPtr xylemPtr phloemPtr fiberPtr vesselPtr fiber vessel ray
AT1G67250 Proteasome maturation factor U... Potri.017G111900 0 1
AT2G39960 Microsomal signal peptidase 25... Potri.008G064700 1.00 0.8959
AT1G76200 unknown protein Potri.005G248600 3.46 0.8876
AT5G07960 unknown protein Potri.015G056300 4.00 0.8886
AT4G31300 PBA1 N-terminal nucleophile aminohy... Potri.018G145900 4.69 0.8521 Pt-PBA1.1
AT5G66140 PAD2 proteasome alpha subunit D2 (.... Potri.009G133800 4.89 0.8561 Pt-PAD1.3
AT5G52210 ATGB1, ATARLB1 GTP-binding protein 1 (.1.2) Potri.015G140400 5.29 0.8476
AT5G47030 ATPase, F1 complex, delta/epsi... Potri.014G053000 6.70 0.8476 Pt-PPFRU36.1
AT3G51260 PAD1 20S proteasome alpha subunit ... Potri.004G174200 7.34 0.8526 Pt-PAD1.2
AT3G27430 PBB1 N-terminal nucleophile aminohy... Potri.004G066000 9.48 0.8435 Pt-PBB1.2
AT3G60540 Preprotein translocase Sec, Se... Potri.002G143100 10.95 0.8525

Potri.017G111900 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.