Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser] Popgenie AspWood
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT1G67265 62 / 1e-15 DVL3, RTFL21 DEVIL 3, ROTUNDIFOLIA like 21 (.1) AT1G68825 59 / 4e-14 DVL5, RTFL15 DEVIL 5, ROTUNDIFOLIA like 15 (.1.2) AT1G13245 57 / 2e-13 RTFL17, DVL4 DEVIL 4, ROTUNDIFOLIA like 17 (.1) AT5G16023 57 / 2e-13 RTFL18, DVL1 DEVIL 1, ROTUNDIFOLIA like 18 (.1) AT3G02493 55 / 2e-12 DVL2, RTFL19, DVL12 DEVIL 2, ROTUNDIFOLIA like 19 (.1) AT3G25717 51 / 6e-11 RTFL16, DVL6 DEVIL 6, ROTUNDIFOLIA like 16 (.1) AT1G07490 43 / 2e-07 RTFL3, DVL9 DEVIL 9, ROTUNDIFOLIA like 3 (.1) AT4G13395 42 / 2e-07 DVL10, RTFL12 DEVIL 10, ROTUNDIFOLIA like 12 (.1) AT3G55515 42 / 4e-07 DVL8, RTFL7 DEVIL 8, ROTUNDIFOLIA like 7 (.1) AT2G29125 42 / 6e-07 RTFL2, DVL13 DEVIL 13, ROTUNDIFOLIA like 2 (.1)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.004G102950 [exp] 87 / 3e-25 AT1G67265 64 / 4e-16 DEVIL 3, ROTUNDIFOLIA like 21 (.1) Potri.010G129600 [exp] 65 / 2e-16 AT1G13245 75 / 1e-20 DEVIL 4, ROTUNDIFOLIA like 17 (.1) Potri.008G116700 [exp] 64 / 3e-16 AT1G13245 76 / 6e-21 DEVIL 4, ROTUNDIFOLIA like 17 (.1) Potri.008G035900 [exp] 45 / 1e-08 AT2G36985 66 / 1e-16 ROTUNDIFOLIA4, DEVIL 16, DVL family protein (.1) Potri.010G226250 [exp] 44 / 5e-08 AT2G36985 67 / 3e-17 ROTUNDIFOLIA4, DEVIL 16, DVL family protein (.1) Potri.014G138900 [exp] 43 / 8e-08 AT3G63088 56 / 7e-13 DEVIL 14, ROTUNDIFOLIA like 14 (.1) Potri.001G242800 [exp] 42 / 4e-07 AT2G29125 71 / 4e-17 DEVIL 13, ROTUNDIFOLIA like 2 (.1) Potri.009G034300 [exp] 41 / 9e-07 AT2G29125 64 / 9e-15 DEVIL 13, ROTUNDIFOLIA like 2 (.1) Potri.006G125600 [exp] 40 / 9e-07 AT2G36985 75 / 3e-20 ROTUNDIFOLIA4, DEVIL 16, DVL family protein (.1)
Flax homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10034272 [exp] 60 / 2e-14 AT1G13245 72 / 5e-19 DEVIL 4, ROTUNDIFOLIA like 17 (.1) Lus10041491 [exp] 55 / 2e-12 AT1G13245 66 / 1e-16 DEVIL 4, ROTUNDIFOLIA like 17 (.1) Lus10034071 [exp] 50 / 2e-10 AT5G16023 56 / 2e-12 DEVIL 1, ROTUNDIFOLIA like 18 (.1) Lus10003079 [exp] 50 / 2e-10 AT5G16023 55 / 3e-12 DEVIL 1, ROTUNDIFOLIA like 18 (.1) Lus10002705 [exp] 42 / 6e-07 AT2G39705 86 / 1e-23 DEVIL 11, ROTUNDIFOLIA like 8 (.1) Lus10040784 [exp] 42 / 9e-07 AT5G59510 84 / 1e-21 DEVIL 18, ROTUNDIFOLIA like 5 (.1) Lus10041846 [exp] 40 / 2e-06 AT4G35783 59 / 1e-13 DEVIL 17, ROTUNDIFOLIA like 6 (.1) Lus10028393 [exp] 40 / 2e-06 AT4G35783 60 / 5e-14 DEVIL 17, ROTUNDIFOLIA like 6 (.1) Lus10001569 [exp] 40 / 4e-06 AT5G59510 79 / 8e-20 DEVIL 18, ROTUNDIFOLIA like 5 (.1) Lus10023399 [exp] 40 / 4e-06 AT2G39705 91 / 3e-25 DEVIL 11, ROTUNDIFOLIA like 8 (.1)
PFAM info	Clan ID Clan name Pfam ID Pfam name Pfam description PF08137 [poplar] [flax] DVL DVL family
Representative CDS sequence Show only first row Show all	>Potri.017G112100.1 pacid=42814413 polypeptide=Potri.017G112100.1.p locus=Potri.017G112100 ID=Potri.017G112100.1.v4.1 annot-version=v4.1 ATGAAGATGATGAGCGGCGAAACCATGGGAGAGTCCAAGAAGAAGATTTCATGCAGAAGGCTTGGAGGATACCTTAGACAACAGAAAGGAAGGCTCTACA TTATTAGGAGATGTGTAGTCATGCTTGTCTGCTGGCATGACTAA
AA sequence Show only first row Show all	>Potri.017G112100.1 pacid=42814413 polypeptide=Potri.017G112100.1.p locus=Potri.017G112100 ID=Potri.017G112100.1.v4.1 annot-version=v4.1 MKMMSGETMGESKKKISCRRLGGYLRQQKGRLYIIRRCVVMLVCWHD

---

DESeq2's median of ratios [POPLAR]

Mapped by: StringTie Salmon Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	NWA:WT	NWB:WT	NWA:OE-ARK2	NWB:OE-ARK2	NWA:miRNA-ARK2	NWB:miRNA-ARK2	NW 0hr	WT H20	WT-NW	TUA1dEY NW	TUA1dEY+TUB15 NW	TUA1dY+TUB9 NW	Pde NW	NWA:WT GA	NWBWT GA	TW:WT	TW:WT GA	NWA:OE-ARK2 GA	NWB:OE-ARK2 GA	TW:OE-ARK2	TW:OE-ARK2 GA	NWA:miRNA-ARK2 GA	NWB:miRNA-ARK2 GA	TW:miRNA-ARK2	TW:miRNA-ARK2 GA	TW 2hr	TW 8hr	TW 24hr	TW 48hr	TW 96hr	TW 336hr	WT ACC	35S::etr1-1 H20	35S::etr1-1 ACC	LMX5::etr1-1 H20	LMX5::etr1-1 ACC	WT-TW	TUA1dEY TW	TUA1dEY+TUB15 TW	TUA1dY+TUB9 TW	Pde TW	OW:WT	OW:WT GA	OW:OE-ARK2	OW:OE-ARK2 GA	OW:miRNA-ARK2	OW:miRNA-ARK2 GA	OW 2hr	OW 8hr	OW 24hr	OW 48hr	OW 96hr	OW 336hr	Root CTR	Root LongCold	Root LongDrougt	Root LongHeat	Root LongSalt	Root ShortCold	Root ShortDrougt	Root ShortHeat	Root ShortSalt	Ptr root	Leaf CTR	Leaf LongCold	Leaf LongDrougt	Leaf LongHeat	Leaf LongSalt	Leaf ShortCold	Leaf ShortDrougt	Leaf ShortHeat	Leaf ShortSalt	Ptr leaf	Stem CTR	Stem LongCold	Stem LongDrougt	Stem LongHeat	Stem LongSalt	Stem ShortCold	Stem ShortDrougt	Stem ShortHeat	Stem ShortSalt	Ptr shoot	Ptr xylem	Ptr phloem	Ptr fiber	Ptr vessel	Ptr fiber vessel ray
AT1G67265		DVL3, RTFL21	DEVIL 3, ROTUNDIFOLIA like 21 ...		Potri.017G112100 [exp]	0	1
AT1G74520		ATHVA22A	HVA22 homologue A (.1)		Potri.017G139000 [exp]	2.00	0.8194
AT1G65810			P-loop containing nucleoside t...		Potri.004G077700 [exp]	2.82	0.8336
AT4G38210		ATHEXPALPHA1.23...	EXPANSIN 20, expansin A20 (.1)		Potri.004G208300 [exp]	3.46	0.8061
AT1G65810			P-loop containing nucleoside t...		Potri.004G077650 [exp]	4.58	0.8096
AT1G67265		DVL3, RTFL21	DEVIL 3, ROTUNDIFOLIA like 21 ...		Potri.004G102950 [exp]	5.29	0.7792
AT1G67030	C2H2ZnF	ZFP6	zinc finger protein 6 (.1)		Potri.014G123700 [exp]	6.70	0.7535
AT4G33280	B3	REM16	AP2/B3-like transcriptional fa...		Potri.014G036900 [exp]	8.06	0.7937
AT3G13175			unknown protein		Potri.001G366900 [exp]	9.79	0.7682
AT1G65810			P-loop containing nucleoside t...		Potri.004G077100 [exp]	10.81	0.7560
AT1G03010			Phototropic-responsive NPH3 fa...		Potri.014G133500 [exp]	11.83	0.7664

Compare expression of checked genes

Potri.017G112100 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.