Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser] Popgenie AspWood
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT3G25780 172 / 2e-54 AOC3, AOC2 allene oxide cyclase 3 (.1) AT3G25760 168 / 6e-53 AOC1, ERD12 early-responsive to dehydration 12, allene oxide cyclase 1 (.1) AT3G25770 166 / 2e-52 AOC2, AOC3 allene oxide cyclase 2 (.1) AT1G13280 166 / 3e-52 AOC4 allene oxide cyclase 4 (.1)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.004G102500 [exp] 189 / 2e-61 AT3G25780 261 / 6e-88 allene oxide cyclase 3 (.1) Potri.008G117300 [exp] 174 / 3e-55 AT3G25780 275 / 4e-93 allene oxide cyclase 3 (.1)
Flax homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10017571 [exp] 184 / 2e-59 AT3G25780 266 / 6e-90 allene oxide cyclase 3 (.1) Lus10033535 [exp] 184 / 3e-59 AT3G25780 264 / 6e-89 allene oxide cyclase 3 (.1)
PFAM info	Clan ID Clan name Pfam ID Pfam name Pfam description CL0650 [poplar] [flax] AOC_barrel PF06351 [poplar] [flax] Allene_ox_cyc Allene oxide cyclase
Representative CDS sequence Show only first row Show all	>Potri.017G112400.1 pacid=42813092 polypeptide=Potri.017G112400.1.p locus=Potri.017G112400 ID=Potri.017G112400.1.v4.1 annot-version=v4.1 ATGGCTGACACTTATGGGAAGCAGATGGAGGAGGGAAAGCCTGTCAATACTCTTGGTGATCTTGTGCCTTTCAGCAACAAACTTTACACCGGAGACCTAC AGAAACGCATAGGAATAACAGCAGGAATATGCATTCTGATCCAACACAAAACGGAAAAGCAAGGTGACCGGTATGAGGCAGTCTACAGCTTCTACTTTGG TGACTACGGTCACCTTTCGGTGCAGGGAGCTTATATTACCTACGAGGACACGTATCTCGCTGTGACTGGTGGGTCAGGTATTTTTGAAGGGCATATGCTG TTTTACACATTTTATTTGAAGGGTCTTAAGAACGATTTGCCTGAGGAGCTGGTTGGGAAGCCTGTTGAGCCAACCCCTGCTGTTGAGCCGACCCCTGCGG CTAAGGCTGCTGAGCCACATGCTACCATTGCTAATTATAGTGATTAA
AA sequence Show only first row Show all	>Potri.017G112400.1 pacid=42813092 polypeptide=Potri.017G112400.1.p locus=Potri.017G112400 ID=Potri.017G112400.1.v4.1 annot-version=v4.1 MADTYGKQMEEGKPVNTLGDLVPFSNKLYTGDLQKRIGITAGICILIQHKTEKQGDRYEAVYSFYFGDYGHLSVQGAYITYEDTYLAVTGGSGIFEGHML FYTFYLKGLKNDLPEELVGKPVEPTPAVEPTPAAKAAEPHATIANYSD

---

DESeq2's median of ratios [POPLAR]

Mapped by: StringTie Salmon Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	NWA:WT	NWB:WT	NWA:OE-ARK2	NWB:OE-ARK2	NWA:miRNA-ARK2	NWB:miRNA-ARK2	NW 0hr	WT H20	WT-NW	TUA1dEY NW	TUA1dEY+TUB15 NW	TUA1dY+TUB9 NW	Pde NW	NWA:WT GA	NWBWT GA	TW:WT	TW:WT GA	NWA:OE-ARK2 GA	NWB:OE-ARK2 GA	TW:OE-ARK2	TW:OE-ARK2 GA	NWA:miRNA-ARK2 GA	NWB:miRNA-ARK2 GA	TW:miRNA-ARK2	TW:miRNA-ARK2 GA	TW 2hr	TW 8hr	TW 24hr	TW 48hr	TW 96hr	TW 336hr	WT ACC	35S::etr1-1 H20	35S::etr1-1 ACC	LMX5::etr1-1 H20	LMX5::etr1-1 ACC	WT-TW	TUA1dEY TW	TUA1dEY+TUB15 TW	TUA1dY+TUB9 TW	Pde TW	OW:WT	OW:WT GA	OW:OE-ARK2	OW:OE-ARK2 GA	OW:miRNA-ARK2	OW:miRNA-ARK2 GA	OW 2hr	OW 8hr	OW 24hr	OW 48hr	OW 96hr	OW 336hr	Root CTR	Root LongCold	Root LongDrougt	Root LongHeat	Root LongSalt	Root ShortCold	Root ShortDrougt	Root ShortHeat	Root ShortSalt	Ptr root	Leaf CTR	Leaf LongCold	Leaf LongDrougt	Leaf LongHeat	Leaf LongSalt	Leaf ShortCold	Leaf ShortDrougt	Leaf ShortHeat	Leaf ShortSalt	Ptr leaf	Stem CTR	Stem LongCold	Stem LongDrougt	Stem LongHeat	Stem LongSalt	Stem ShortCold	Stem ShortDrougt	Stem ShortHeat	Stem ShortSalt	Ptr shoot	Ptr xylem	Ptr phloem	Ptr fiber	Ptr vessel	Ptr fiber vessel ray
AT3G25780		AOC3, AOC2	allene oxide cyclase 3 (.1)		Potri.017G112400 [exp]	0	1
					Potri.019G125100 [exp]	4.12	0.7600
AT3G26040			HXXXD-type acyl-transferase fa...		Potri.015G127000 [exp]	9.94	0.5671
AT3G24255			RNA-directed DNA polymerase (r...		Potri.010G000101 [exp]	31.60	0.6701
AT3G44680		HDA09, HDA9	histone deacetylase 9 (.1)		Potri.011G156250 [exp]	58.77	0.5490
AT4G02550			unknown protein		Potri.006G191850 [exp]	63.87	0.6452
AT1G16930			F-box/RNI-like/FBD-like domain...		Potri.011G121400 [exp]	76.40	0.5222
AT1G61290		ATSYP124, SYP12...	syntaxin of plants 124 (.1)		Potri.004G035400 [exp]	82.17	0.6139	SYP124.1
AT1G51120	AP2_ERF		AP2/B3 transcription factor fa...		Potri.003G212800 [exp]	93.38	0.5645	RAV3
AT5G42240		SCPL42	serine carboxypeptidase-like 4...		Potri.005G187700 [exp]	110.42	0.5548
AT4G16295		SPH1	S-protein homologue 1 (.1)		Potri.004G199700 [exp]	129.33	0.5276

Compare expression of checked genes

Potri.017G112400 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.