Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser] Popgenie AspWood
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT1G13340 211 / 1e-65 Regulator of Vps4 activity in the MVB pathway protein (.1) AT1G25420 142 / 2e-40 Regulator of Vps4 activity in the MVB pathway protein (.1.2.3) AT4G35730 141 / 1e-38 Regulator of Vps4 activity in the MVB pathway protein (.1) AT1G34220 140 / 1e-37 Regulator of Vps4 activity in the MVB pathway protein (.1.2) AT2G19710 124 / 6e-32 Regulator of Vps4 activity in the MVB pathway protein (.1) AT4G29440 107 / 8e-26 Regulator of Vps4 activity in the MVB pathway protein (.1.2) AT2G14830 103 / 4e-25 Regulator of Vps4 activity in the MVB pathway protein (.1.2) AT4G32350 94 / 3e-21 Regulator of Vps4 activity in the MVB pathway protein (.1) AT1G79910 92 / 3e-21 Regulator of Vps4 activity in the MVB pathway protein (.1.2) AT1G52315 84 / 2e-18 Regulator of Vps4 activity in the MVB pathway protein (.1)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.004G100900 [exp] 406 / 2e-139 AT1G13340 223 / 1e-66 Regulator of Vps4 activity in the MVB pathway protein (.1) Potri.010G127000 [exp] 245 / 1e-78 AT1G13340 268 / 1e-85 Regulator of Vps4 activity in the MVB pathway protein (.1) Potri.008G121300 [exp] 148 / 2e-42 AT1G25420 361 / 3e-125 Regulator of Vps4 activity in the MVB pathway protein (.1.2.3) Potri.019G087400 [exp] 152 / 4e-42 AT1G34220 357 / 5e-116 Regulator of Vps4 activity in the MVB pathway protein (.1.2) Potri.013G117100 [exp] 147 / 4e-40 AT1G34220 357 / 2e-115 Regulator of Vps4 activity in the MVB pathway protein (.1.2) Potri.006G149800 [exp] 145 / 4e-39 AT2G19710 300 / 3e-86 Regulator of Vps4 activity in the MVB pathway protein (.1) Potri.007G059800 [exp] 139 / 7e-38 AT4G35730 385 / 7e-130 Regulator of Vps4 activity in the MVB pathway protein (.1) Potri.013G135700 [exp] 103 / 1e-24 AT2G14830 228 / 2e-67 Regulator of Vps4 activity in the MVB pathway protein (.1.2) Potri.004G038600 [exp] 98 / 9e-23 AT2G14830 175 / 3e-48 Regulator of Vps4 activity in the MVB pathway protein (.1.2)
Flax homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10041468 [exp] 246 / 4e-79 AT1G13340 239 / 1e-74 Regulator of Vps4 activity in the MVB pathway protein (.1) Lus10033552 [exp] 241 / 2e-78 AT1G13340 208 / 6e-64 Regulator of Vps4 activity in the MVB pathway protein (.1) Lus10034303 [exp] 240 / 1e-76 AT1G13340 243 / 5e-76 Regulator of Vps4 activity in the MVB pathway protein (.1) Lus10017592 [exp] 208 / 2e-65 AT1G13340 178 / 3e-52 Regulator of Vps4 activity in the MVB pathway protein (.1) Lus10017591 [exp] 189 / 2e-59 AT1G13340 158 / 3e-46 Regulator of Vps4 activity in the MVB pathway protein (.1) Lus10041836 [exp] 147 / 7e-41 AT4G35730 423 / 2e-145 Regulator of Vps4 activity in the MVB pathway protein (.1) Lus10006061 [exp] 142 / 5e-39 AT1G34220 417 / 2e-140 Regulator of Vps4 activity in the MVB pathway protein (.1.2) Lus10028383 [exp] 142 / 6e-39 AT4G35730 415 / 2e-142 Regulator of Vps4 activity in the MVB pathway protein (.1) Lus10033553 [exp] 139 / 1e-38 AT1G13340 107 / 6e-26 Regulator of Vps4 activity in the MVB pathway protein (.1) Lus10028724 [exp] 140 / 3e-38 AT1G34220 417 / 1e-140 Regulator of Vps4 activity in the MVB pathway protein (.1.2)
PFAM info	Clan ID Clan name Pfam ID Pfam name Pfam description PF03398 [poplar] [flax] Ist1 Regulator of Vps4 activity in the MVB pathway
Representative CDS sequence Show only first row Show all	>Potri.017G113900.1 pacid=42814591 polypeptide=Potri.017G113900.1.p locus=Potri.017G113900 ID=Potri.017G113900.1.v4.1 annot-version=v4.1 ATGGGAAAGAAACTGGATGCTCTTTTCCGGAGGAAACTCAAGACCTCTAAATTCAGTTCTCTAGCAAAACTAGCAATATCTAGGATCGTCATCCTCAAGA ACCAGAGACAAGCCAGGCTTTCCCTTGCAAAGTCTGATGTTATTCAGCTCCTTAACCTTGGACACCAAGAAAGAGCTCTACTTCGCGTTGAGCATGTCAT CAAGGATCAGAATATGCTGGGTGCTTTTGATATGATGGAGGATTACTTACATTTCCTGATCGAAAGAGTTGTTCAACTTGAAACAAACAAAGAGTGTCCT GAGTTCAAGGAGGCAATATCGAGCTTGATCTTTGCATCTTCCAGATGTGGTGAGTTTCCAGAGTTGCAAGAGATTCGTGGAGTTTTCACAACGAGATTTG GAAACGAATTCGCTGCTCGTGCTGTCGAGTTGCGCAGAAACTGCGGAGTGCATCCTAATATTATACAAAATCTTTCTGCAAGACAACCAAGCTTGGAAAG CAGAAAGAAACTGCTAAAGGACATTGCAACTGAGAATGGTATCATCCTGCATTTGGAGGAAGATGCTCCTGTGGTTGCACAAGAAAATCTGGATGTCGAC CAGCCAAAGCAGCAGCAGCATGAATATAAATCAGTCAAGTTAGATGCTACCGAGTACCAAGCCAGAACCCACGTTTTGCCGGAGGAGGAGCTGTCCGGAT CATTGAAAGGAAGGAAATACAAAGATGTAGCTTCTGCAGCTCTAGATGCTTTTGAATCAGCAGCTTACGCAGCACATGCTGCAAGAGCTGCTGTTGAACT CTCAAGATATGAATCTCAGGACAATGAACAATATGGTCATGGTGATTCTAGTCATGGATAA
AA sequence Show only first row Show all	>Potri.017G113900.1 pacid=42814591 polypeptide=Potri.017G113900.1.p locus=Potri.017G113900 ID=Potri.017G113900.1.v4.1 annot-version=v4.1 MGKKLDALFRRKLKTSKFSSLAKLAISRIVILKNQRQARLSLAKSDVIQLLNLGHQERALLRVEHVIKDQNMLGAFDMMEDYLHFLIERVVQLETNKECP EFKEAISSLIFASSRCGEFPELQEIRGVFTTRFGNEFAARAVELRRNCGVHPNIIQNLSARQPSLESRKKLLKDIATENGIILHLEEDAPVVAQENLDVD QPKQQQHEYKSVKLDATEYQARTHVLPEEELSGSLKGRKYKDVASAALDAFESAAYAAHAARAAVELSRYESQDNEQYGHGDSSHG

---

DESeq2's median of ratios [POPLAR]

Mapped by: StringTie Salmon Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	NWA:WT	NWB:WT	NWA:OE-ARK2	NWB:OE-ARK2	NWA:miRNA-ARK2	NWB:miRNA-ARK2	NW 0hr	WT H20	WT-NW	TUA1dEY NW	TUA1dEY+TUB15 NW	TUA1dY+TUB9 NW	Pde NW	NWA:WT GA	NWBWT GA	TW:WT	TW:WT GA	NWA:OE-ARK2 GA	NWB:OE-ARK2 GA	TW:OE-ARK2	TW:OE-ARK2 GA	NWA:miRNA-ARK2 GA	NWB:miRNA-ARK2 GA	TW:miRNA-ARK2	TW:miRNA-ARK2 GA	TW 2hr	TW 8hr	TW 24hr	TW 48hr	TW 96hr	TW 336hr	WT ACC	35S::etr1-1 H20	35S::etr1-1 ACC	LMX5::etr1-1 H20	LMX5::etr1-1 ACC	WT-TW	TUA1dEY TW	TUA1dEY+TUB15 TW	TUA1dY+TUB9 TW	Pde TW	OW:WT	OW:WT GA	OW:OE-ARK2	OW:OE-ARK2 GA	OW:miRNA-ARK2	OW:miRNA-ARK2 GA	OW 2hr	OW 8hr	OW 24hr	OW 48hr	OW 96hr	OW 336hr	Root CTR	Root LongCold	Root LongDrougt	Root LongHeat	Root LongSalt	Root ShortCold	Root ShortDrougt	Root ShortHeat	Root ShortSalt	Ptr root	Leaf CTR	Leaf LongCold	Leaf LongDrougt	Leaf LongHeat	Leaf LongSalt	Leaf ShortCold	Leaf ShortDrougt	Leaf ShortHeat	Leaf ShortSalt	Ptr leaf	Stem CTR	Stem LongCold	Stem LongDrougt	Stem LongHeat	Stem LongSalt	Stem ShortCold	Stem ShortDrougt	Stem ShortHeat	Stem ShortSalt	Ptr shoot	Ptr xylem	Ptr phloem	Ptr fiber	Ptr vessel	Ptr fiber vessel ray
AT1G13340			Regulator of Vps4 activity in ...		Potri.017G113900 [exp]	0	1
AT3G13840	GRAS		GRAS family transcription fact...		Potri.001G168800 [exp]	5.19	0.9384
AT5G15130	WRKY	ATWRKY72, WRKY7...	ARABIDOPSIS THALIANA WRKY DNA-...		Potri.017G079500 [exp]	5.19	0.9576	Pt-WRKY72.1
AT1G52540			Protein kinase superfamily pro...		Potri.012G132200 [exp]	7.61	0.9473
AT2G26710		CYP72B1, CYP734...	PHYB ACTIVATION TAGGED SUPPRES...		Potri.010G139400 [exp]	14.69	0.9380
AT2G15490		UGT73B4	UDP-glycosyltransferase 73B4 (...		Potri.006G272600 [exp]	16.09	0.9370
					Potri.001G019890 [exp]	18.49	0.9366
AT2G45360			Protein of unknown function (D...		Potri.014G068900 [exp]	19.62	0.9327
AT1G52540			Protein kinase superfamily pro...		Potri.015G134500 [exp]	20.97	0.9366
AT2G38940		PHT1;4, ATPT2	ARABIDOPSIS THALIANA PHOSPHATE...		Potri.010G071600 [exp]	21.67	0.9342
					Potri.007G082600 [exp]	26.49	0.9166

Compare expression of checked genes

Potri.017G113900 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.