Potri.017G115400 [POPLAR]


External link
JGI Phytozome v13PopgenieAspWood                  
Symbol
Arabidopsis homologues
Locus ID BLAST score/e-value TF class Alias TAIR10 short description
AT3G02560 315 / 3e-111 Ribosomal protein S7e family protein (.1.2)
AT5G16130 312 / 5e-110 Ribosomal protein S7e family protein (.1)
AT1G48830 308 / 3e-108 Ribosomal protein S7e family protein (.1.2)
Paralogs
Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Potri.004G099200 379 / 2e-136 AT3G02560 314 / 6e-111 Ribosomal protein S7e family protein (.1.2)
Potri.006G087900 378 / 4e-136 AT3G02560 316 / 2e-111 Ribosomal protein S7e family protein (.1.2)
Potri.016G100400 372 / 6e-134 AT3G02560 313 / 1e-110 Ribosomal protein S7e family protein (.1.2)
Potri.015G046100 109 / 1e-31 AT1G48830 110 / 1e-32 Ribosomal protein S7e family protein (.1.2)
Flax homologues
Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Lus10034909 325 / 5e-115 AT1G48830 331 / 1e-117 Ribosomal protein S7e family protein (.1.2)
Lus10017497 322 / 5e-114 AT1G48830 325 / 3e-115 Ribosomal protein S7e family protein (.1.2)
Lus10023638 322 / 6e-114 AT1G48830 330 / 4e-117 Ribosomal protein S7e family protein (.1.2)
Lus10028789 323 / 4e-111 AT1G48830 330 / 2e-113 Ribosomal protein S7e family protein (.1.2)
PFAM info
Clan ID Clan name Pfam ID Pfam name Pfam description
CL0652 S24e_L23_L15e PF01251 Ribosomal_S7e Ribosomal protein S7e
Representative CDS sequence
>Potri.017G115400.1 pacid=42813931 polypeptide=Potri.017G115400.1.p locus=Potri.017G115400 ID=Potri.017G115400.1.v4.1 annot-version=v4.1
ATGTACACCACAAAGAAGAAGATCCAAAAGGACAAGGATGCTGAACCCACCGAGTTTGAGGAGACAGTTGCCCAGGCTTTATTTGATTTGGAAAATAGCA
ATTCAGACCTGAAAAGTGAGCTAAAAGATCTCTTCATAAATTCTGCAGTTCAAATAGATGTTGCTGGAAATCGTAAAGCTATTGTCATTTATGTTCCCTA
TAGACTGAGGAAGTCTTATCGCAAGGTTCATCTTCGCCTTGTTAGAGAGCTGGAGAAAAAGTTCAGTGGGAAGGATGTTGTTCTGCTTGCTACCCGAAGG
ATTGTGCGTCCACCCAAGAAAGGCTCTGCTGTTCAGCGCCCCCGTTCCCGCACCCTAACTGCCGTGCATGAAGCCATGCTTGAGGATTTAGTGTATCCTG
CTGAGATTGTTGGAAAACGCACCAGATACAGGATTGATGGGTCCAAAATTAGCAAGATCTTCTTGGATCCCAAGGAGCGCAACAACACTGAGTACAAGCT
GGAGTCGTATGCTGGAGTTTACAGGAAGCTTACAGGAAAAGATGTGGTTTTTGATTTCCCCGTAACAGAGGCCTGA
AA sequence
>Potri.017G115400.1 pacid=42813931 polypeptide=Potri.017G115400.1.p locus=Potri.017G115400 ID=Potri.017G115400.1.v4.1 annot-version=v4.1
MYTTKKKIQKDKDAEPTEFEETVAQALFDLENSNSDLKSELKDLFINSAVQIDVAGNRKAIVIYVPYRLRKSYRKVHLRLVRELEKKFSGKDVVLLATRR
IVRPPKKGSAVQRPRSRTLTAVHEAMLEDLVYPAEIVGKRTRYRIDGSKISKIFLDPKERNNTEYKLESYAGVYRKLTGKDVVFDFPVTEA

DESeq2's median of ratios [POPLAR]

Mapped by: Order by: Show schematic diagram

Coexpressed genes

Only top 10 genes are shown Show allDownload tab-delimited text
Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.
At best At TF class At alias At description Locus MR r Symbol NWA:WTNWB:WTNWA:OE-ARK2NWB:OE-ARK2NWA:miRNA-ARK2NWB:miRNA-ARK2NW 0hrWT H20WT-NWTUA1dEY NWTUA1dEY+TUB15 NWTUA1dY+TUB9 NWPde NWNWA:WT GANWBWT GATW:WTTW:WT GANWA:OE-ARK2 GANWB:OE-ARK2 GATW:OE-ARK2TW:OE-ARK2 GANWA:miRNA-ARK2 GANWB:miRNA-ARK2 GATW:miRNA-ARK2TW:miRNA-ARK2 GATW 2hrTW 8hrTW 24hrTW 48hrTW 96hrTW 336hrWT ACC35S::etr1-1 H2035S::etr1-1 ACCLMX5::etr1-1 H20LMX5::etr1-1 ACCWT-TWTUA1dEY TWTUA1dEY+TUB15 TWTUA1dY+TUB9 TWPde TWOW:WTOW:WT GAOW:OE-ARK2OW:OE-ARK2 GAOW:miRNA-ARK2OW:miRNA-ARK2 GAOW 2hrOW 8hrOW 24hrOW 48hrOW 96hrOW 336hrRoot CTRRoot LongColdRoot LongDrougtRoot LongHeatRoot LongSaltRoot ShortColdRoot ShortDrougtRoot ShortHeatRoot ShortSaltPtr rootLeaf CTRLeaf LongColdLeaf LongDrougtLeaf LongHeatLeaf LongSaltLeaf ShortColdLeaf ShortDrougtLeaf ShortHeatLeaf ShortSaltPtr leafStem CTRStem LongColdStem LongDrougtStem LongHeatStem LongSaltStem ShortColdStem ShortDrougtStem ShortHeatStem ShortSaltPtr shootPtr xylemPtr phloemPtr fiberPtr vesselPtr fiber vessel ray
AT3G02560 Ribosomal protein S7e family p... Potri.017G115400 0 1
AT2G27530 PGY1 PIGGYBACK1, Ribosomal protein ... Potri.004G202832 1.00 0.9851
AT4G25740 RNA binding Plectin/S10 domain... Potri.004G073500 2.23 0.9795
AT3G05590 RPL18 ribosomal protein L18 (.1) Potri.014G127300 2.44 0.9812 RPL18.10
AT3G02560 Ribosomal protein S7e family p... Potri.004G099200 2.82 0.9795
AT4G18100 Ribosomal protein L32e (.1) Potri.001G353900 3.16 0.9759 Pt-RPL32.2
AT1G67430 Ribosomal protein L22p/L17e fa... Potri.015G094400 3.16 0.9841 RPL17.2
AT3G52580 Ribosomal protein S11 family p... Potri.004G131800 4.24 0.9773 Pt-RPS14.4
AT3G04840 Ribosomal protein S3Ae (.1) Potri.008G156300 4.24 0.9793 RS3.2
AT1G15250 Zinc-binding ribosomal protein... Potri.018G036900 4.35 0.9697
AT4G09800 RPS18C S18 ribosomal protein (.1) Potri.005G211200 4.58 0.9790

Potri.017G115400 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.