Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser] Popgenie AspWood
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT1G67025 47 / 2e-07 unknown protein AT1G66880 46 / 5e-07 Protein kinase superfamily protein (.1) AT1G66920 44 / 2e-06 Protein kinase superfamily protein (.1.2) AT5G38250 43 / 7e-06 Protein kinase family protein (.1) AT1G18390 39 / 9e-05 Protein kinase superfamily protein (.1.2) AT5G38210 39 / 0.0002 Protein kinase family protein (.1) AT1G67000 37 / 0.0006 Protein kinase superfamily protein (.1) AT1G69910 37 / 0.001 Protein kinase superfamily protein (.1)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.017G118100 [exp] 72 / 4e-16 AT5G38210 575 / 0.0 Protein kinase family protein (.1) Potri.017G118250 [exp] 65 / 1e-13 AT5G38210 542 / 0.0 Protein kinase family protein (.1) Potri.017G117120 [exp] 64 / 2e-13 AT5G38260 430 / 2e-142 Protein kinase superfamily protein (.1) Potri.004G096675 [exp] 62 / 8e-13 AT5G38260 99 / 1e-23 Protein kinase superfamily protein (.1) Potri.004G096900 [exp] 60 / 4e-12 AT5G38210 557 / 0.0 Protein kinase family protein (.1) Potri.017G116900 [exp] 52 / 3e-09 AT1G66910 477 / 2e-160 Protein kinase superfamily protein (.1) Potri.004G096550 [exp] 50 / 2e-08 AT5G38210 594 / 0.0 Protein kinase family protein (.1) Potri.017G116955 [exp] 48 / 9e-08 AT1G66920 389 / 5e-128 Protein kinase superfamily protein (.1.2) Potri.017G117065 [exp] 47 / 3e-07 AT1G66920 449 / 3e-150 Protein kinase superfamily protein (.1.2)
Flax homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10028494 [exp] 50 / 1e-08 AT1G66880 480 / 2e-152 Protein kinase superfamily protein (.1) Lus10009151 [exp] 49 / 3e-08 AT1G66880 129 / 2e-32 Protein kinase superfamily protein (.1) Lus10039725 [exp] 46 / 5e-07 AT4G03230 445 / 5e-144 S-locus lectin protein kinase family protein (.1)
PFAM info
Representative CDS sequence Show only first row Show all	>Potri.017G117230.1 pacid=42813859 polypeptide=Potri.017G117230.1.p locus=Potri.017G117230 ID=Potri.017G117230.1.v4.1 annot-version=v4.1 ATGCTACCTTTGCCAATGATGACGAGCGATATTAGTTATCCTTTCTGGGGATCCAATTGGCCTGCATACTGTGGCTATCCGAAGTTGGAGCTCAATTGCA GAAACCAGGATCTGGAGATCACAATCAAGCAATTGACATACAAAGTCCTTCACATACAAAAACCAGTCACGGACTCTCAGCGTTTCCCGGTCAGATTGTG CAGAAAACATCTGCCCCACACTCCTCAGCACCACTTGGATTCCCAATTTTTTGAACTACACATCTGA
AA sequence Show only first row Show all	>Potri.017G117230.1 pacid=42813859 polypeptide=Potri.017G117230.1.p locus=Potri.017G117230 ID=Potri.017G117230.1.v4.1 annot-version=v4.1 MLPLPMMTSDISYPFWGSNWPAYCGYPKLELNCRNQDLEITIKQLTYKVLHIQKPVTDSQRFPVRLCRKHLPHTPQHHLDSQFFELHI

---

DESeq2's median of ratios [POPLAR]

Mapped by: StringTie Salmon Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	NWA:WT	NWB:WT	NWA:OE-ARK2	NWB:OE-ARK2	NWA:miRNA-ARK2	NWB:miRNA-ARK2	NW 0hr	WT H20	WT-NW	TUA1dEY NW	TUA1dEY+TUB15 NW	TUA1dY+TUB9 NW	Pde NW	NWA:WT GA	NWBWT GA	TW:WT	TW:WT GA	NWA:OE-ARK2 GA	NWB:OE-ARK2 GA	TW:OE-ARK2	TW:OE-ARK2 GA	NWA:miRNA-ARK2 GA	NWB:miRNA-ARK2 GA	TW:miRNA-ARK2	TW:miRNA-ARK2 GA	TW 2hr	TW 8hr	TW 24hr	TW 48hr	TW 96hr	TW 336hr	WT ACC	35S::etr1-1 H20	35S::etr1-1 ACC	LMX5::etr1-1 H20	LMX5::etr1-1 ACC	WT-TW	TUA1dEY TW	TUA1dEY+TUB15 TW	TUA1dY+TUB9 TW	Pde TW	OW:WT	OW:WT GA	OW:OE-ARK2	OW:OE-ARK2 GA	OW:miRNA-ARK2	OW:miRNA-ARK2 GA	OW 2hr	OW 8hr	OW 24hr	OW 48hr	OW 96hr	OW 336hr	Root CTR	Root LongCold	Root LongDrougt	Root LongHeat	Root LongSalt	Root ShortCold	Root ShortDrougt	Root ShortHeat	Root ShortSalt	Ptr root	Leaf CTR	Leaf LongCold	Leaf LongDrougt	Leaf LongHeat	Leaf LongSalt	Leaf ShortCold	Leaf ShortDrougt	Leaf ShortHeat	Leaf ShortSalt	Ptr leaf	Stem CTR	Stem LongCold	Stem LongDrougt	Stem LongHeat	Stem LongSalt	Stem ShortCold	Stem ShortDrougt	Stem ShortHeat	Stem ShortSalt	Ptr shoot	Ptr xylem	Ptr phloem	Ptr fiber	Ptr vessel	Ptr fiber vessel ray
AT1G67025			unknown protein		Potri.017G117230 [exp]	0	1
AT2G26530		AR781	Protein of unknown function (D...		Potri.001G274000 [exp]	3.87	0.9539
AT1G03150			Acyl-CoA N-acyltransferases (N...		Potri.002G052000 [exp]	4.69	0.9266
AT4G23330			unknown protein		Potri.003G127900 [exp]	5.83	0.9278
					Potri.001G029000 [exp]	7.00	0.9151
					Potri.001G426980 [exp]	8.48	0.8966
					Potri.009G072966 [exp]	9.59	0.8832
AT1G10280			Core-2/I-branching beta-1,6-N-...		Potri.004G228100 [exp]	11.48	0.9308
AT5G41315	bHLH	MYC6.2, GL3	GLABROUS 3, GLABRA 3, basic he...		Potri.003G128000 [exp]	14.21	0.8187	Pt-GL3.2
					Potri.003G013856 [exp]	15.36	0.9452
AT5G37930			Protein with RING/U-box and TR...		Potri.017G148100 [exp]	15.36	0.8701

Compare expression of checked genes

Potri.017G117230 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.