Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser] Popgenie AspWood
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT1G66940 61 / 4e-11 protein kinase-related (.1.2.3) AT5G38210 56 / 3e-09 Protein kinase family protein (.1) AT1G66880 54 / 1e-08 Protein kinase superfamily protein (.1) AT5G38260 52 / 9e-08 Protein kinase superfamily protein (.1) AT1G66910 51 / 1e-07 Protein kinase superfamily protein (.1) AT5G38250 46 / 6e-06 Protein kinase family protein (.1) AT1G67000 44 / 3e-05 Protein kinase superfamily protein (.1) AT5G38240 43 / 5e-05 Protein kinase family protein (.1) AT1G18390 43 / 7e-05 Protein kinase superfamily protein (.1.2) AT1G67025 39 / 0.0005 unknown protein
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.017G117285 [exp] 299 / 2e-98 AT1G66920 439 / 2e-146 Protein kinase superfamily protein (.1.2) Potri.017G117065 [exp] 240 / 8e-76 AT1G66920 449 / 3e-150 Protein kinase superfamily protein (.1.2) Potri.017G116955 [exp] 228 / 4e-72 AT1G66920 389 / 5e-128 Protein kinase superfamily protein (.1.2) Potri.004G096550 [exp] 189 / 1e-56 AT5G38210 594 / 0.0 Protein kinase family protein (.1) Potri.004G096900 [exp] 71 / 2e-14 AT5G38210 557 / 0.0 Protein kinase family protein (.1) Potri.017G118250 [exp] 71 / 3e-14 AT5G38210 542 / 0.0 Protein kinase family protein (.1) Potri.017G116900 [exp] 71 / 4e-14 AT1G66910 477 / 2e-160 Protein kinase superfamily protein (.1) Potri.017G117340 [exp] 69 / 9e-14 AT5G38260 456 / 9e-153 Protein kinase superfamily protein (.1) Potri.004G096675 [exp] 67 / 2e-13 AT5G38260 99 / 1e-23 Protein kinase superfamily protein (.1)
Flax homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10009151 [exp] 61 / 5e-11 AT1G66880 129 / 2e-32 Protein kinase superfamily protein (.1) Lus10028494 [exp] 56 / 5e-09 AT1G66880 480 / 2e-152 Protein kinase superfamily protein (.1) Lus10039725 [exp] 52 / 8e-08 AT4G03230 445 / 5e-144 S-locus lectin protein kinase family protein (.1) Lus10016737 [exp] 40 / 0.0005 AT1G18390 544 / 0.0 Protein kinase superfamily protein (.1.2)
PFAM info	Clan ID Clan name Pfam ID Pfam name Pfam description PF14380 [poplar] [flax] WAK_assoc Wall-associated receptor kinase C-terminal
Representative CDS sequence Show only first row Show all	>Potri.017G118401.1 pacid=42813642 polypeptide=Potri.017G118401.1.p locus=Potri.017G118401 ID=Potri.017G118401.1.v4.1 annot-version=v4.1 ATGAATATCAATCAGGTTGCATATCGTGTTTTGGGAATCCATCAGGATGATAGAATTCTCAGGATTGCAACAGAGGACTCCTTTGTTGGATTGTGTTCAC CTCAATTTATGAACAGCATGTTCAATCCTAAGGTTTTCGAGTCTGTTGAGGGTTACACAAATCTGATATTCATTTATGGTTGCAAGGATGGTCCTCCAAC CATACCTTTCACTTGCAAAATAAATAAGGTTAATGATCAAGATGTTTATATCCAAGTAGGAGATACTGGTCCTGGCGAATGCTATCGTAGTGTCTTAGTG CCATTTTCTATAACAAATTGGCCACGAATCCAACAACCTGTTACTGTCCAAGTTTTGGAAGAACAGTTGAGAAAAGGATTCGAGGTAAGATGGAAGGTCG ATAGGCCGGAGGCGTGTGGGGAATGCATCAGGTCTAAAGGAGTTTGTGGTATTGACCATGTAACTAAGCAAACAACTTGTTACTGTCCAAATCAATCAAG TGGATCAAAAACATGTGCTCGAGGTATGTACCTCAACTTCTCCTCGAATCAGTTCATGATCAACTCCAGTCACTTGTTGATGCTTCACATACCTTAG
AA sequence Show only first row Show all	>Potri.017G118401.1 pacid=42813642 polypeptide=Potri.017G118401.1.p locus=Potri.017G118401 ID=Potri.017G118401.1.v4.1 annot-version=v4.1 MNINQVAYRVLGIHQDDRILRIATEDSFVGLCSPQFMNSMFNPKVFESVEGYTNLIFIYGCKDGPPTIPFTCKINKVNDQDVYIQVGDTGPGECYRSVLV PFSITNWPRIQQPVTVQVLEEQLRKGFEVRWKVDRPEACGECIRSKGVCGIDHVTKQTTCYCPNQSSGSKTCARGMYLNFSSNQFMINSSHLLMLHIP

---

DESeq2's median of ratios [POPLAR]

Mapped by: StringTie Salmon Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	NWA:WT	NWB:WT	NWA:OE-ARK2	NWB:OE-ARK2	NWA:miRNA-ARK2	NWB:miRNA-ARK2	NW 0hr	WT H20	WT-NW	TUA1dEY NW	TUA1dEY+TUB15 NW	TUA1dY+TUB9 NW	Pde NW	NWA:WT GA	NWBWT GA	TW:WT	TW:WT GA	NWA:OE-ARK2 GA	NWB:OE-ARK2 GA	TW:OE-ARK2	TW:OE-ARK2 GA	NWA:miRNA-ARK2 GA	NWB:miRNA-ARK2 GA	TW:miRNA-ARK2	TW:miRNA-ARK2 GA	TW 2hr	TW 8hr	TW 24hr	TW 48hr	TW 96hr	TW 336hr	WT ACC	35S::etr1-1 H20	35S::etr1-1 ACC	LMX5::etr1-1 H20	LMX5::etr1-1 ACC	WT-TW	TUA1dEY TW	TUA1dEY+TUB15 TW	TUA1dY+TUB9 TW	Pde TW	OW:WT	OW:WT GA	OW:OE-ARK2	OW:OE-ARK2 GA	OW:miRNA-ARK2	OW:miRNA-ARK2 GA	OW 2hr	OW 8hr	OW 24hr	OW 48hr	OW 96hr	OW 336hr	Root CTR	Root LongCold	Root LongDrougt	Root LongHeat	Root LongSalt	Root ShortCold	Root ShortDrougt	Root ShortHeat	Root ShortSalt	Ptr root	Leaf CTR	Leaf LongCold	Leaf LongDrougt	Leaf LongHeat	Leaf LongSalt	Leaf ShortCold	Leaf ShortDrougt	Leaf ShortHeat	Leaf ShortSalt	Ptr leaf	Stem CTR	Stem LongCold	Stem LongDrougt	Stem LongHeat	Stem LongSalt	Stem ShortCold	Stem ShortDrougt	Stem ShortHeat	Stem ShortSalt	Ptr shoot	Ptr xylem	Ptr phloem	Ptr fiber	Ptr vessel	Ptr fiber vessel ray
AT1G66940			protein kinase-related (.1.2.3...		Potri.017G118401 [exp]	0	1
AT4G24010		CSLG2, ATCSLG1	ARABIDOPSIS THALIANA CELLULOSE...		Potri.010G074700 [exp]	2.82	0.8934
AT2G25620		AtDBP1	DNA-binding protein phosphatas...		Potri.006G059600 [exp]	4.24	0.8796
AT5G38210			Protein kinase family protein ...		Potri.017G118250 [exp]	4.24	0.9274
AT1G66920			Protein kinase superfamily pro...		Potri.017G117285 [exp]	5.09	0.9391
AT1G28200		FIP1	FH interacting protein 1 (.1)		Potri.002G102800 [exp]	12.40	0.8839	Pt-FIP1.3
AT1G30620		MURUS4, HSR8, U...	UDP-D-XYLOSE 4-EPIMERASE 1, MU...		Potri.006G022000 [exp]	16.27	0.9079
AT5G43060			Granulin repeat cysteine prote...		Potri.014G024100 [exp]	19.62	0.8955	RD21.1
AT5G60710			Zinc finger (C3HC4-type RING f...		Potri.009G010350 [exp]	19.89	0.8888
AT3G10960		ATAZG1	AZA-guanine resistant1 (.1)		Potri.013G083300 [exp]	20.59	0.8306
AT1G80300		ATNTT1	nucleotide transporter 1 (.1)		Potri.003G058900 [exp]	21.00	0.8927	AATP1.2

Compare expression of checked genes

Potri.017G118401 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.