Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser] Popgenie AspWood
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT3G18280 87 / 5e-24 Bifunctional inhibitor/lipid-transfer protein/seed storage 2S albumin superfamily protein (.1) AT1G73780 83 / 3e-22 Bifunctional inhibitor/lipid-transfer protein/seed storage 2S albumin superfamily protein (.1) AT1G48750 79 / 1e-20 Bifunctional inhibitor/lipid-transfer protein/seed storage 2S albumin superfamily protein (.1) AT5G38170 70 / 4e-17 Bifunctional inhibitor/lipid-transfer protein/seed storage 2S albumin superfamily protein (.1) AT1G66850 69 / 9e-17 Bifunctional inhibitor/lipid-transfer protein/seed storage 2S albumin superfamily protein (.1) AT5G38195 67 / 4e-16 Bifunctional inhibitor/lipid-transfer protein/seed storage 2S albumin superfamily protein (.1) AT5G38160 62 / 5e-14 Bifunctional inhibitor/lipid-transfer protein/seed storage 2S albumin superfamily protein (.1) AT5G38180 60 / 3e-13 Bifunctional inhibitor/lipid-transfer protein/seed storage 2S albumin superfamily protein (.1) AT1G43667 56 / 2e-11 Bifunctional inhibitor/lipid-transfer protein/seed storage 2S albumin superfamily protein (.1) AT5G38197 54 / 5e-11 Bifunctional inhibitor/lipid-transfer protein/seed storage 2S albumin superfamily protein (.1)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.004G096000 [exp] 114 / 2e-34 AT3G18280 82 / 6e-22 Bifunctional inhibitor/lipid-transfer protein/seed storage 2S albumin superfamily protein (.1) Potri.015G044500 [exp] 91 / 1e-25 AT3G18280 109 / 8e-33 Bifunctional inhibitor/lipid-transfer protein/seed storage 2S albumin superfamily protein (.1) Potri.012G054300 [exp] 82 / 8e-22 AT3G18280 103 / 3e-30 Bifunctional inhibitor/lipid-transfer protein/seed storage 2S albumin superfamily protein (.1)
Flax homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10017616 [exp] 82 / 2e-21 AT3G18280 100 / 1e-28 Bifunctional inhibitor/lipid-transfer protein/seed storage 2S albumin superfamily protein (.1) Lus10033574 [exp] 78 / 3e-20 AT3G18280 97 / 8e-28 Bifunctional inhibitor/lipid-transfer protein/seed storage 2S albumin superfamily protein (.1) Lus10013030 [exp] 70 / 6e-17 AT3G18280 109 / 1e-32 Bifunctional inhibitor/lipid-transfer protein/seed storage 2S albumin superfamily protein (.1) Lus10029131 [exp] 69 / 1e-16 AT3G18280 108 / 2e-32 Bifunctional inhibitor/lipid-transfer protein/seed storage 2S albumin superfamily protein (.1) Lus10017615 [exp] 67 / 7e-16 AT5G38195 91 / 1e-25 Bifunctional inhibitor/lipid-transfer protein/seed storage 2S albumin superfamily protein (.1) Lus10033573 [exp] 67 / 7e-16 AT5G38195 92 / 9e-26 Bifunctional inhibitor/lipid-transfer protein/seed storage 2S albumin superfamily protein (.1)
PFAM info	Clan ID Clan name Pfam ID Pfam name Pfam description CL0482 [poplar] [flax] Prolamin PF14368 [poplar] [flax] LTP_2 Probable lipid transfer
Representative CDS sequence Show only first row Show all	>Potri.017G118700.1 pacid=42813117 polypeptide=Potri.017G118700.1.p locus=Potri.017G118700 ID=Potri.017G118700.1.v4.1 annot-version=v4.1 ATGAAGATGGCGTCTTTTTTCATGATTGTGATGGTGGTCGCGACGATGTTACTAGCTGAAGCACAAGTGTCACAAGCACAGACATGTAACCCAGGGCAGT TGAGCCCATGCCTAGGAGCAATCATGTCCTCTACACCACCCTCCACCACTTGCTGCAGCAAATTGAAGGAGCAGAAGCCTTGTCTCTGTGGATACCTCAA GGATCCGAGCCTCAAGCAGTTTGTTTCCTCTCCTGGTGCTAGAAAGGTGGCTAGCGATTGTGGCGTTCCCTACCCTAGTTGCTAA
AA sequence Show only first row Show all	>Potri.017G118700.1 pacid=42813117 polypeptide=Potri.017G118700.1.p locus=Potri.017G118700 ID=Potri.017G118700.1.v4.1 annot-version=v4.1 MKMASFFMIVMVVATMLLAEAQVSQAQTCNPGQLSPCLGAIMSSTPPSTTCCSKLKEQKPCLCGYLKDPSLKQFVSSPGARKVASDCGVPYPSC

---

DESeq2's median of ratios [POPLAR]

Mapped by: StringTie Salmon Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	NWA:WT	NWB:WT	NWA:OE-ARK2	NWB:OE-ARK2	NWA:miRNA-ARK2	NWB:miRNA-ARK2	NW 0hr	WT H20	WT-NW	TUA1dEY NW	TUA1dEY+TUB15 NW	TUA1dY+TUB9 NW	Pde NW	NWA:WT GA	NWBWT GA	TW:WT	TW:WT GA	NWA:OE-ARK2 GA	NWB:OE-ARK2 GA	TW:OE-ARK2	TW:OE-ARK2 GA	NWA:miRNA-ARK2 GA	NWB:miRNA-ARK2 GA	TW:miRNA-ARK2	TW:miRNA-ARK2 GA	TW 2hr	TW 8hr	TW 24hr	TW 48hr	TW 96hr	TW 336hr	WT ACC	35S::etr1-1 H20	35S::etr1-1 ACC	LMX5::etr1-1 H20	LMX5::etr1-1 ACC	WT-TW	TUA1dEY TW	TUA1dEY+TUB15 TW	TUA1dY+TUB9 TW	Pde TW	OW:WT	OW:WT GA	OW:OE-ARK2	OW:OE-ARK2 GA	OW:miRNA-ARK2	OW:miRNA-ARK2 GA	OW 2hr	OW 8hr	OW 24hr	OW 48hr	OW 96hr	OW 336hr	Root CTR	Root LongCold	Root LongDrougt	Root LongHeat	Root LongSalt	Root ShortCold	Root ShortDrougt	Root ShortHeat	Root ShortSalt	Ptr root	Leaf CTR	Leaf LongCold	Leaf LongDrougt	Leaf LongHeat	Leaf LongSalt	Leaf ShortCold	Leaf ShortDrougt	Leaf ShortHeat	Leaf ShortSalt	Ptr leaf	Stem CTR	Stem LongCold	Stem LongDrougt	Stem LongHeat	Stem LongSalt	Stem ShortCold	Stem ShortDrougt	Stem ShortHeat	Stem ShortSalt	Ptr shoot	Ptr xylem	Ptr phloem	Ptr fiber	Ptr vessel	Ptr fiber vessel ray
AT3G18280			Bifunctional inhibitor/lipid-t...		Potri.017G118700 [exp]	0	1
AT5G63500			Protein of unknown function (D...		Potri.012G100100 [exp]	1.41	0.8242
AT5G16740			Transmembrane amino acid trans...		Potri.002G233100 [exp]	2.82	0.8125
AT3G62930			Thioredoxin superfamily protei...		Potri.002G209000 [exp]	4.47	0.7833
AT2G28680			RmlC-like cupins superfamily p...		Potri.007G047200 [exp]	9.48	0.7379
AT1G30840		ATPUP4	purine permease 4 (.1.2)		Potri.003G156900 [exp]	11.48	0.7406
AT1G22590	MADS	AGL87	AGAMOUS-like 87 (.1.2)		Potri.013G107600 [exp]	11.83	0.7738
AT5G16740			Transmembrane amino acid trans...		Potri.002G233200 [exp]	12.64	0.7546
AT3G11050		ATFER2	ferritin 2 (.1)		Potri.008G072700 [exp]	14.14	0.7253	PFE2.2
AT3G16520		UGT88A1	UDP-glucosyl transferase 88A1 ...		Potri.015G027800 [exp]	19.49	0.7481
AT3G24060			Plant self-incompatibility pro...		Potri.001G053100 [exp]	21.56	0.7841

Compare expression of checked genes

Potri.017G118700 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.