Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser] Popgenie AspWood
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT1G16740 235 / 1e-81 Ribosomal protein L20 (.1) ATCG00660 64 / 6e-14 ATCG00660.1, RPL20 ribosomal protein L20 (.1)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.004G095475 [exp] 116 / 3e-35 AT1G16740 107 / 4e-32 Ribosomal protein L20 (.1)
Flax homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10029597 [exp] 229 / 2e-79 AT1G16740 213 / 7e-73 Ribosomal protein L20 (.1) Lus10006327 [exp] 228 / 9e-79 AT1G16740 213 / 1e-72 Ribosomal protein L20 (.1) Lus10034785 [exp] 226 / 4e-77 AT1G16740 212 / 2e-71 Ribosomal protein L20 (.1) Lus10033326 [exp] 223 / 8e-77 AT1G16740 206 / 3e-70 Ribosomal protein L20 (.1)
PFAM info	Clan ID Clan name Pfam ID Pfam name Pfam description PF00453 [poplar] [flax] Ribosomal_L20 Ribosomal protein L20
Representative CDS sequence Show only first row Show all	>Potri.017G119300.1 pacid=42814223 polypeptide=Potri.017G119300.1.p locus=Potri.017G119300 ID=Potri.017G119300.1.v4.1 annot-version=v4.1 ATGAACAAGAAGGAAATATTCAAACTAGCAAAAGGGTTTAGAGGAAGAGCAAAGAACTGTATAAGGATAGCAAGAGAAAGGGTTGAGAAGGCCTTGCAGT ACTCTTACAGAGATCGCCGCAACAAGAAGAGGGACATGCGCTCTCTTTGGATCCAACGCATCAATGCTGGCACCCGCCAACATGGTGTTAATTATGGTAA CTTCATGCATGGGCTGATGAAGGAGAACATTCAGCTGAACAGAAAAGTCTTATCAGAGATATCCATGCATGAACCATATAGTTTCAAGGCCCTGGTAGAC ATCTCACGTAATGCCTTTCCTGGAAACAAAAATGTGGTGCATCCTCCCAGGAAAGTGGATATGTCTGCTGTTAATGTGTAG
AA sequence Show only first row Show all	>Potri.017G119300.1 pacid=42814223 polypeptide=Potri.017G119300.1.p locus=Potri.017G119300 ID=Potri.017G119300.1.v4.1 annot-version=v4.1 MNKKEIFKLAKGFRGRAKNCIRIARERVEKALQYSYRDRRNKKRDMRSLWIQRINAGTRQHGVNYGNFMHGLMKENIQLNRKVLSEISMHEPYSFKALVD ISRNAFPGNKNVVHPPRKVDMSAVNV

---

DESeq2's median of ratios [POPLAR]

Mapped by: StringTie Salmon Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	NWA:WT	NWB:WT	NWA:OE-ARK2	NWB:OE-ARK2	NWA:miRNA-ARK2	NWB:miRNA-ARK2	NW 0hr	WT H20	WT-NW	TUA1dEY NW	TUA1dEY+TUB15 NW	TUA1dY+TUB9 NW	Pde NW	NWA:WT GA	NWBWT GA	TW:WT	TW:WT GA	NWA:OE-ARK2 GA	NWB:OE-ARK2 GA	TW:OE-ARK2	TW:OE-ARK2 GA	NWA:miRNA-ARK2 GA	NWB:miRNA-ARK2 GA	TW:miRNA-ARK2	TW:miRNA-ARK2 GA	TW 2hr	TW 8hr	TW 24hr	TW 48hr	TW 96hr	TW 336hr	WT ACC	35S::etr1-1 H20	35S::etr1-1 ACC	LMX5::etr1-1 H20	LMX5::etr1-1 ACC	WT-TW	TUA1dEY TW	TUA1dEY+TUB15 TW	TUA1dY+TUB9 TW	Pde TW	OW:WT	OW:WT GA	OW:OE-ARK2	OW:OE-ARK2 GA	OW:miRNA-ARK2	OW:miRNA-ARK2 GA	OW 2hr	OW 8hr	OW 24hr	OW 48hr	OW 96hr	OW 336hr	Root CTR	Root LongCold	Root LongDrougt	Root LongHeat	Root LongSalt	Root ShortCold	Root ShortDrougt	Root ShortHeat	Root ShortSalt	Ptr root	Leaf CTR	Leaf LongCold	Leaf LongDrougt	Leaf LongHeat	Leaf LongSalt	Leaf ShortCold	Leaf ShortDrougt	Leaf ShortHeat	Leaf ShortSalt	Ptr leaf	Stem CTR	Stem LongCold	Stem LongDrougt	Stem LongHeat	Stem LongSalt	Stem ShortCold	Stem ShortDrougt	Stem ShortHeat	Stem ShortSalt	Ptr shoot	Ptr xylem	Ptr phloem	Ptr fiber	Ptr vessel	Ptr fiber vessel ray
AT1G16740			Ribosomal protein L20 (.1)		Potri.017G119300 [exp]	0	1
AT2G31725			Eukaryotic protein of unknown ...		Potri.013G127400 [exp]	1.00	0.9320
AT3G57290		ATINT6, ATEIF3E...	eukaryotic translation initiat...		Potri.006G047600 [exp]	3.46	0.9222	EIF3.4
AT2G20585		NFD6	nuclear fusion defective 6 (.1...		Potri.007G137500 [exp]	6.92	0.8994
AT4G11630			Ribosomal protein L19 family p...		Potri.012G086800 [exp]	9.00	0.9023
AT3G20000		TOM40	translocase of the outer mitoc...		Potri.007G000200 [exp]	11.40	0.9011	Pt-TOM40.1
AT2G19080			metaxin-related (.1)		Potri.006G077100 [exp]	12.44	0.8833
AT3G55605			Mitochondrial glycoprotein fam...		Potri.010G198500 [exp]	12.64	0.8830
AT5G39850			Ribosomal protein S4 (.1)		Potri.016G076800 [exp]	13.85	0.8929
AT1G70190			Ribosomal protein L7/L12, olig...		Potri.003G074800 [exp]	14.07	0.8528
AT3G19760		EIF4A-III	eukaryotic initiation factor 4...		Potri.007G070000 [exp]	15.62	0.8438

Compare expression of checked genes

Potri.017G119300 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.