Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser] Popgenie AspWood
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT1G72690 92 / 4e-26 unknown protein AT5G57000 77 / 8e-19 unknown protein AT1G17490 69 / 6e-17 unknown protein
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.004G095300 [exp] 136 / 1e-43 AT1G72690 57 / 3e-12 unknown protein Potri.006G148000 [exp] 106 / 1e-30 AT5G57000 83 / 2e-20 unknown protein
Flax homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10015607 [exp] 79 / 6e-20 AT1G72690 84 / 6e-21 unknown protein Lus10006884 [exp] 79 / 2e-19 AT5G57000 85 / 2e-21 unknown protein Lus10008389 [exp] 70 / 4e-17 AT1G72690 76 / 2e-19 unknown protein Lus10006016 [exp] 63 / 4e-13 AT3G13898 76 / 4e-17 unknown protein
PFAM info
Representative CDS sequence Show only first row Show all	>Potri.017G119600.1 pacid=42814055 polypeptide=Potri.017G119600.1.p locus=Potri.017G119600 ID=Potri.017G119600.1.v4.1 annot-version=v4.1 ATGGCAGAACCAAAAGCAGACCAAAAATATCCTTCACCATCAGAAGAAAAGGATGTAAAAGCGCCAAATGTGATTGAAATATCCAAGGAAGAGATAGAGG CAATCGTTCATGGTGGAAAATCTCCACGCCATTATAAGGAAACACATGGAAGAAGTGATGATATTGATGAGGATACCCCCATAGATGAAGTTAAAGGACC AAGTGTGTTTGAACGAATCAAGGAAGAGATCGAAGCCCTTGTTGGGGCTATTCATCCTAAGAAGGACAAGAGTGACGTGTCTTCTTCTTAG
AA sequence Show only first row Show all	>Potri.017G119600.1 pacid=42814055 polypeptide=Potri.017G119600.1.p locus=Potri.017G119600 ID=Potri.017G119600.1.v4.1 annot-version=v4.1 MAEPKADQKYPSPSEEKDVKAPNVIEISKEEIEAIVHGGKSPRHYKETHGRSDDIDEDTPIDEVKGPSVFERIKEEIEALVGAIHPKKDKSDVSSS

---

DESeq2's median of ratios [POPLAR]

Mapped by: StringTie Salmon Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	NWA:WT	NWB:WT	NWA:OE-ARK2	NWB:OE-ARK2	NWA:miRNA-ARK2	NWB:miRNA-ARK2	NW 0hr	WT H20	WT-NW	TUA1dEY NW	TUA1dEY+TUB15 NW	TUA1dY+TUB9 NW	Pde NW	NWA:WT GA	NWBWT GA	TW:WT	TW:WT GA	NWA:OE-ARK2 GA	NWB:OE-ARK2 GA	TW:OE-ARK2	TW:OE-ARK2 GA	NWA:miRNA-ARK2 GA	NWB:miRNA-ARK2 GA	TW:miRNA-ARK2	TW:miRNA-ARK2 GA	TW 2hr	TW 8hr	TW 24hr	TW 48hr	TW 96hr	TW 336hr	WT ACC	35S::etr1-1 H20	35S::etr1-1 ACC	LMX5::etr1-1 H20	LMX5::etr1-1 ACC	WT-TW	TUA1dEY TW	TUA1dEY+TUB15 TW	TUA1dY+TUB9 TW	Pde TW	OW:WT	OW:WT GA	OW:OE-ARK2	OW:OE-ARK2 GA	OW:miRNA-ARK2	OW:miRNA-ARK2 GA	OW 2hr	OW 8hr	OW 24hr	OW 48hr	OW 96hr	OW 336hr	Root CTR	Root LongCold	Root LongDrougt	Root LongHeat	Root LongSalt	Root ShortCold	Root ShortDrougt	Root ShortHeat	Root ShortSalt	Ptr root	Leaf CTR	Leaf LongCold	Leaf LongDrougt	Leaf LongHeat	Leaf LongSalt	Leaf ShortCold	Leaf ShortDrougt	Leaf ShortHeat	Leaf ShortSalt	Ptr leaf	Stem CTR	Stem LongCold	Stem LongDrougt	Stem LongHeat	Stem LongSalt	Stem ShortCold	Stem ShortDrougt	Stem ShortHeat	Stem ShortSalt	Ptr shoot	Ptr xylem	Ptr phloem	Ptr fiber	Ptr vessel	Ptr fiber vessel ray
AT1G72690			unknown protein		Potri.017G119600 [exp]	0	1
AT2G16050			Cysteine/Histidine-rich C1 dom...		Potri.009G110500 [exp]	1.41	0.8795
AT1G10155		ATPP2-A10	phloem protein 2-A10 (.1)		Potri.012G120340 [exp]	3.46	0.8711
AT2G22570		NIC2, ATNIC1	A. THALIANA NICOTINAMIDASE 1, ...		Potri.007G116100 [exp]	8.36	0.8676
AT3G16520		UGT88A1	UDP-glucosyl transferase 88A1 ...		Potri.017G150000 [exp]	12.72	0.8564
AT5G09330	NAC	VNI1, ANAC082	VND-interacting 1, NAC domain ...		Potri.007G109100 [exp]	13.19	0.8667
AT1G06570		HPPD, HPD, PDS1	4-hydroxyphenylpyruvate dioxyg...		Potri.002G057400 [exp]	13.85	0.8723	PDS1.2
AT3G13540	MYB	ATMYB5, ATM2	myb domain protein 5 (.1)		Potri.003G219900 [exp]	14.00	0.8631
AT2G30140			UDP-Glycosyltransferase superf...		Potri.001G282100 [exp]	16.49	0.8321
AT1G77920	bZIP		bZIP transcription factor fami...		Potri.002G090700 [exp]	17.02	0.8511	TGA3.1
AT4G36760		ATAPP1	ARABIDOPSIS THALIANA AMINOPEPT...		Potri.007G029700 [exp]	17.23	0.8233	APP1.2

Compare expression of checked genes

Potri.017G119600 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.