Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser] Popgenie AspWood
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT3G28540 136 / 5e-38 P-loop containing nucleoside triphosphate hydrolases superfamily protein (.1.2) AT3G28510 133 / 9e-37 P-loop containing nucleoside triphosphate hydrolases superfamily protein (.1) AT3G28600 127 / 6e-35 P-loop containing nucleoside triphosphate hydrolases superfamily protein (.1) AT3G28610 126 / 2e-34 P-loop containing nucleoside triphosphate hydrolases superfamily protein (.1) AT3G28580 122 / 5e-33 P-loop containing nucleoside triphosphate hydrolases superfamily protein (.1) AT5G40010 122 / 6e-33 ASD, AATP1 ATPase-in-Seed-Development, AAA-ATPase 1 (.1) AT3G28520 119 / 7e-32 P-loop containing nucleoside triphosphate hydrolases superfamily protein (.1) AT3G28570 117 / 1e-31 P-loop containing nucleoside triphosphate hydrolases superfamily protein (.1) AT5G40000 112 / 2e-29 P-loop containing nucleoside triphosphate hydrolases superfamily protein (.1) AT3G50930 101 / 3e-25 BCS1 cytochrome BC1 synthesis (.1)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.004G091500 [exp] 165 / 6e-49 AT5G40010 582 / 0.0 ATPase-in-Seed-Development, AAA-ATPase 1 (.1) Potri.013G047950 [exp] 149 / 6e-43 AT5G40010 538 / 0.0 ATPase-in-Seed-Development, AAA-ATPase 1 (.1) Potri.013G047900 [exp] 148 / 1e-42 AT5G40010 537 / 0.0 ATPase-in-Seed-Development, AAA-ATPase 1 (.1) Potri.019G020800 [exp] 148 / 2e-42 AT5G40010 526 / 0.0 ATPase-in-Seed-Development, AAA-ATPase 1 (.1) Potri.004G012601 [exp] 147 / 2e-42 AT5G40010 566 / 0.0 ATPase-in-Seed-Development, AAA-ATPase 1 (.1) Potri.004G012700 [exp] 147 / 2e-42 AT5G40010 566 / 0.0 ATPase-in-Seed-Development, AAA-ATPase 1 (.1) Potri.004G012500 [exp] 142 / 2e-40 AT5G40010 556 / 0.0 ATPase-in-Seed-Development, AAA-ATPase 1 (.1) Potri.015G067400 [exp] 140 / 7e-40 AT5G40010 538 / 0.0 ATPase-in-Seed-Development, AAA-ATPase 1 (.1) Potri.012G072300 [exp] 134 / 5e-39 AT3G28610 306 / 6e-102 P-loop containing nucleoside triphosphate hydrolases superfamily protein (.1)
Flax homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10015354 [exp] 152 / 3e-44 AT5G40010 598 / 0.0 ATPase-in-Seed-Development, AAA-ATPase 1 (.1) Lus10014496 [exp] 133 / 7e-37 AT5G40010 577 / 0.0 ATPase-in-Seed-Development, AAA-ATPase 1 (.1) Lus10015349 [exp] 131 / 3e-36 AT5G40010 536 / 0.0 ATPase-in-Seed-Development, AAA-ATPase 1 (.1) Lus10004258 [exp] 124 / 1e-33 AT3G28580 507 / 1e-176 P-loop containing nucleoside triphosphate hydrolases superfamily protein (.1) Lus10042166 [exp] 122 / 1e-32 AT5G40010 526 / 0.0 ATPase-in-Seed-Development, AAA-ATPase 1 (.1) Lus10030667 [exp] 120 / 3e-32 AT5G40010 501 / 2e-174 ATPase-in-Seed-Development, AAA-ATPase 1 (.1) Lus10014498 [exp] 119 / 1e-31 AT5G40010 598 / 0.0 ATPase-in-Seed-Development, AAA-ATPase 1 (.1) Lus10005256 [exp] 117 / 6e-31 AT5G40010 501 / 4e-172 ATPase-in-Seed-Development, AAA-ATPase 1 (.1) Lus10006968 [exp] 102 / 2e-26 AT5G57480 399 / 3e-137 P-loop containing nucleoside triphosphate hydrolases superfamily protein (.1) Lus10032188 [exp] 98 / 5e-24 AT5G40010 497 / 4e-173 ATPase-in-Seed-Development, AAA-ATPase 1 (.1)
PFAM info
Representative CDS sequence Show only first row Show all	>Potri.017G123800.1 pacid=42814120 polypeptide=Potri.017G123800.1.p locus=Potri.017G123800 ID=Potri.017G123800.1.v4.1 annot-version=v4.1 ATGGCTAATTTCTTGGGTTATGATGTTTATGATCTTGAGTTGACCACAGTCAAGGACAACAGCGATCTTAGGAAGCTATTGATCGAAACCACTGGAAAAT CTATCATCGTGATTGAGGATATTGATTGCTCACTTGATCTTACAGGACAGAGGAAGAAAAAGGAGAAAGATGAGAATGATGCCGAAACAGGAAAAGAGAA GGATCCAATTTCTAAGAAGAAAAGGGAGGCTGAAGAAGAGAGCAAACGCACTAGTAAGGTTACTTTATCAGGGCTTGAATTTCATCGATGGAATCTGGTC AGCATGTGGGGGAGAAAGAATTATTGTGTTCACTACCAATTATGTGGACAGACTGGATCCTGCTTTAATAAGGAGGGGGAGGATGGACAAGAGCATAAAA TGTCATATTGTCGCTTTGAAGCATTCAAGGTGCTAGCCAAGAATTATTTGGAACTCGAGTCCCACGAATTGTTTGGAAAAATTGAAGAGTTGTTGGGGAA GACAGATATCTCCTGCTGA
AA sequence Show only first row Show all	>Potri.017G123800.1 pacid=42814120 polypeptide=Potri.017G123800.1.p locus=Potri.017G123800 ID=Potri.017G123800.1.v4.1 annot-version=v4.1 MANFLGYDVYDLELTTVKDNSDLRKLLIETTGKSIIVIEDIDCSLDLTGQRKKKEKDENDAETGKEKDPISKKKREAEEESKRTSKVTLSGLEFHRWNLV SMWGRKNYCVHYQLCGQTGSCFNKEGEDGQEHKMSYCRFEAFKVLAKNYLELESHELFGKIEELLGKTDISC

---

DESeq2's median of ratios [POPLAR]

Mapped by: StringTie Salmon Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	NWA:WT	NWB:WT	NWA:OE-ARK2	NWB:OE-ARK2	NWA:miRNA-ARK2	NWB:miRNA-ARK2	NW 0hr	WT H20	WT-NW	TUA1dEY NW	TUA1dEY+TUB15 NW	TUA1dY+TUB9 NW	Pde NW	NWA:WT GA	NWBWT GA	TW:WT	TW:WT GA	NWA:OE-ARK2 GA	NWB:OE-ARK2 GA	TW:OE-ARK2	TW:OE-ARK2 GA	NWA:miRNA-ARK2 GA	NWB:miRNA-ARK2 GA	TW:miRNA-ARK2	TW:miRNA-ARK2 GA	TW 2hr	TW 8hr	TW 24hr	TW 48hr	TW 96hr	TW 336hr	WT ACC	35S::etr1-1 H20	35S::etr1-1 ACC	LMX5::etr1-1 H20	LMX5::etr1-1 ACC	WT-TW	TUA1dEY TW	TUA1dEY+TUB15 TW	TUA1dY+TUB9 TW	Pde TW	OW:WT	OW:WT GA	OW:OE-ARK2	OW:OE-ARK2 GA	OW:miRNA-ARK2	OW:miRNA-ARK2 GA	OW 2hr	OW 8hr	OW 24hr	OW 48hr	OW 96hr	OW 336hr	Root CTR	Root LongCold	Root LongDrougt	Root LongHeat	Root LongSalt	Root ShortCold	Root ShortDrougt	Root ShortHeat	Root ShortSalt	Ptr root	Leaf CTR	Leaf LongCold	Leaf LongDrougt	Leaf LongHeat	Leaf LongSalt	Leaf ShortCold	Leaf ShortDrougt	Leaf ShortHeat	Leaf ShortSalt	Ptr leaf	Stem CTR	Stem LongCold	Stem LongDrougt	Stem LongHeat	Stem LongSalt	Stem ShortCold	Stem ShortDrougt	Stem ShortHeat	Stem ShortSalt	Ptr shoot	Ptr xylem	Ptr phloem	Ptr fiber	Ptr vessel	Ptr fiber vessel ray
AT3G28540			P-loop containing nucleoside t...		Potri.017G123800 [exp]	0	1
AT4G34500			Protein kinase superfamily pro...		Potri.009G115600 [exp]	2.23	0.7419
AT5G48385			FRIGIDA-like protein (.1)		Potri.014G175200 [exp]	6.70	0.7369
AT1G15260			unknown protein		Potri.003G053600 [exp]	9.05	0.6606
AT3G21530			DNAse I-like superfamily prote...		Potri.008G198100 [exp]	14.96	0.7373
AT1G32320		ATMKK10	MAP kinase kinase 10 (.1)		Potri.001G138800 [exp]	21.63	0.7337	Pt-ATMKK10.1
AT2G28110		IRX7, FRA8	IRREGULAR XYLEM 7, FRAGILE FIB...		Potri.009G006500 [exp]	30.98	0.7239
AT1G22040			Galactose oxidase/kelch repeat...		Potri.002G091900 [exp]	31.44	0.6595
AT1G23890			NHL domain-containing protein ...		Potri.004G087300 [exp]	34.94	0.6648
AT4G01850		AtSAM2, SAM-2, ...	S-adenosylmethionine synthetas...		Potri.002G189200 [exp]	35.63	0.7332
AT4G32295			unknown protein		Potri.018G027100 [exp]	36.87	0.6681

Compare expression of checked genes

Potri.017G123800 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.