Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser] Popgenie AspWood
Symbol	Pt-TCH2.1
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT1G66400 155 / 4e-49 CML23 calmodulin like 23 (.1) AT5G37770 154 / 9e-49 CML24, TCH2 TOUCH 2, CALMODULIN-LIKE 24, EF hand calcium-binding protein family (.1) AT1G18210 148 / 3e-46 Calcium-binding EF-hand family protein (.1.2) AT1G73630 143 / 2e-44 EF hand calcium-binding protein family (.1) AT1G24620 124 / 2e-36 EF hand calcium-binding protein family (.1) AT4G03290 116 / 8e-34 EF hand calcium-binding protein family (.1) AT1G05990 112 / 2e-32 RHS1 ,RHS2 ROOT HAIR SPECIFIC 1, EF hand calcium-binding protein family (.1) AT3G07490 112 / 5e-32 AtCML3, AGD11 calmodulin-like 3, ARF-GAP domain 11 (.1) AT2G15680 112 / 7e-32 AtCML30 calmodulin-like 30, Calcium-binding EF-hand family protein (.1) AT2G43290 109 / 2e-30 MSS3 multicopy suppressors of snf4 deficiency in yeast 3, Calcium-binding EF-hand family protein (.1)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.004G089400 [exp] 272 / 2e-95 AT1G66400 157 / 7e-50 calmodulin like 23 (.1) Potri.012G048200 [exp] 143 / 3e-44 AT1G18210 188 / 8e-62 Calcium-binding EF-hand family protein (.1.2) Potri.015G039500 [exp] 142 / 6e-44 AT1G18210 189 / 6e-62 Calcium-binding EF-hand family protein (.1.2) Potri.008G134300 [exp] 132 / 1e-39 AT1G24620 219 / 2e-73 EF hand calcium-binding protein family (.1) Potri.010G107100 [exp] 132 / 3e-39 AT1G24620 220 / 2e-73 EF hand calcium-binding protein family (.1) Potri.009G102500 [exp] 117 / 9e-34 AT2G15680 246 / 3e-84 calmodulin-like 30, Calcium-binding EF-hand family protein (.1) Potri.002G239100 [exp] 114 / 6e-33 AT3G07490 248 / 8e-86 calmodulin-like 3, ARF-GAP domain 11 (.1) Potri.014G070700 [exp] 115 / 9e-33 AT1G18210 94 / 2e-24 Calcium-binding EF-hand family protein (.1.2) Potri.017G029700 [exp] 114 / 2e-32 AT3G07490 192 / 1e-62 calmodulin-like 3, ARF-GAP domain 11 (.1)
Flax homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10009127 [exp] 206 / 1e-67 AT1G66400 147 / 2e-44 calmodulin like 23 (.1) Lus10018012 [exp] 152 / 2e-47 AT1G18210 195 / 2e-64 Calcium-binding EF-hand family protein (.1.2) Lus10009059 [exp] 143 / 5e-44 AT1G18210 197 / 3e-65 Calcium-binding EF-hand family protein (.1.2) Lus10031345 [exp] 138 / 4e-42 AT1G18210 196 / 1e-64 Calcium-binding EF-hand family protein (.1.2) Lus10028516 [exp] 135 / 7e-42 AT1G66400 118 / 4e-35 calmodulin like 23 (.1) Lus10004330 [exp] 128 / 2e-38 AT1G24620 207 / 2e-69 EF hand calcium-binding protein family (.1) Lus10019863 [exp] 127 / 1e-37 AT2G15680 233 / 9e-79 calmodulin-like 30, Calcium-binding EF-hand family protein (.1) Lus10014050 [exp] 127 / 1e-37 AT2G15680 239 / 4e-81 calmodulin-like 30, Calcium-binding EF-hand family protein (.1) Lus10028913 [exp] 126 / 1e-37 AT1G24620 204 / 5e-68 EF hand calcium-binding protein family (.1) Lus10009564 [exp] 117 / 5e-34 AT3G07490 233 / 7e-80 calmodulin-like 3, ARF-GAP domain 11 (.1)
PFAM info	Clan ID Clan name Pfam ID Pfam name Pfam description CL0220 [poplar] [flax] EF_hand PF13499 [poplar] [flax] EF-hand_7 EF-hand domain pair CL0220 [poplar] [flax] EF_hand PF13833 [poplar] [flax] EF-hand_8 EF-hand domain pair
Representative CDS sequence Show only first row Show all	>Potri.017G126200.1 pacid=42814347 polypeptide=Potri.017G126200.1.p locus=Potri.017G126200 ID=Potri.017G126200.1.v4.1 annot-version=v4.1 ATGGCAAAATCAAAAAACCCAACGACCTTCGGTTCCATGGACGACATAAGGAAAATATTCAACAAGTTCGACAAAAATGGAGATGGCAAGATTTCTTGTA GTGAGGTTGTAGACAACCTTAAAGAACTGGGCACCAAGATATCACCAGCGGAAGTCCAGTCCATAATGCAAGAATTCGACAAAGATGGTGATGGCTATAT TGATCTTGATGAGTTTGTCGACTTCATCCAGAATGGTGGACTTGACGATGGCGGTGGCAATGATAGTAAAGAATTGAGGGATGCGTTTGATTTGTATGAT AAAAACAAGAACGGGCTGATTTCAGTTGATGAGTTGCACTCGGTAATGAAGATGTTGGGGTTGAAGTGTAGCTTGAGTGATTGTCGTAAGATGATACGTG AAGTTGATCAAGATGGTGATGGTAATGTTAATTTTGAGGAGTTTAAGAAGATGATGACTAGAGGGTTAGCGTAG
AA sequence Show only first row Show all	>Potri.017G126200.1 pacid=42814347 polypeptide=Potri.017G126200.1.p locus=Potri.017G126200 ID=Potri.017G126200.1.v4.1 annot-version=v4.1 MAKSKNPTTFGSMDDIRKIFNKFDKNGDGKISCSEVVDNLKELGTKISPAEVQSIMQEFDKDGDGYIDLDEFVDFIQNGGLDDGGGNDSKELRDAFDLYD KNKNGLISVDELHSVMKMLGLKCSLSDCRKMIREVDQDGDGNVNFEEFKKMMTRGLA

---

DESeq2's median of ratios [POPLAR]

Mapped by: StringTie Salmon Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	NWA:WT	NWB:WT	NWA:OE-ARK2	NWB:OE-ARK2	NWA:miRNA-ARK2	NWB:miRNA-ARK2	NW 0hr	WT H20	WT-NW	TUA1dEY NW	TUA1dEY+TUB15 NW	TUA1dY+TUB9 NW	Pde NW	NWA:WT GA	NWBWT GA	TW:WT	TW:WT GA	NWA:OE-ARK2 GA	NWB:OE-ARK2 GA	TW:OE-ARK2	TW:OE-ARK2 GA	NWA:miRNA-ARK2 GA	NWB:miRNA-ARK2 GA	TW:miRNA-ARK2	TW:miRNA-ARK2 GA	TW 2hr	TW 8hr	TW 24hr	TW 48hr	TW 96hr	TW 336hr	WT ACC	35S::etr1-1 H20	35S::etr1-1 ACC	LMX5::etr1-1 H20	LMX5::etr1-1 ACC	WT-TW	TUA1dEY TW	TUA1dEY+TUB15 TW	TUA1dY+TUB9 TW	Pde TW	OW:WT	OW:WT GA	OW:OE-ARK2	OW:OE-ARK2 GA	OW:miRNA-ARK2	OW:miRNA-ARK2 GA	OW 2hr	OW 8hr	OW 24hr	OW 48hr	OW 96hr	OW 336hr	Root CTR	Root LongCold	Root LongDrougt	Root LongHeat	Root LongSalt	Root ShortCold	Root ShortDrougt	Root ShortHeat	Root ShortSalt	Ptr root	Leaf CTR	Leaf LongCold	Leaf LongDrougt	Leaf LongHeat	Leaf LongSalt	Leaf ShortCold	Leaf ShortDrougt	Leaf ShortHeat	Leaf ShortSalt	Ptr leaf	Stem CTR	Stem LongCold	Stem LongDrougt	Stem LongHeat	Stem LongSalt	Stem ShortCold	Stem ShortDrougt	Stem ShortHeat	Stem ShortSalt	Ptr shoot	Ptr xylem	Ptr phloem	Ptr fiber	Ptr vessel	Ptr fiber vessel ray
AT1G66400		CML23	calmodulin like 23 (.1)		Potri.017G126200 [exp]	0	1	Pt-TCH2.1
AT1G59590		ZCF37	ZCF37 (.1)		Potri.002G118200 [exp]	2.23	0.8498	ZCF37.1
AT1G18740			Protein of unknown function (D...		Potri.005G192600 [exp]	16.24	0.8187
AT3G25600			Calcium-binding EF-hand family...		Potri.010G132800 [exp]	17.49	0.7932
					Potri.012G124832 [exp]	19.74	0.8328
AT3G02430			Protein of unknown function (D...		Potri.004G223500 [exp]	29.06	0.8200
AT1G27730	C2H2ZnF	ZAT10, STZ	salt tolerance zinc finger (.1...		Potri.001G295500 [exp]	37.62	0.8121
AT2G27080			Late embryogenesis abundant (L...		Potri.009G158900 [exp]	41.15	0.7976
AT3G63520		ATNCED1, ATCCD1...	carotenoid cleavage dioxygenas...		Potri.006G239300 [exp]	45.59	0.7886
					Potri.019G014368 [exp]	48.28	0.8095
AT3G03280			unknown protein		Potri.017G121200 [exp]	53.23	0.8005

Compare expression of checked genes

Potri.017G126200 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.