Plant FIBer expression Database

Potri.017G128500 [POPLAR]


External link
JGI Phytozome v13PopgenieAspWood                  
Symbol
Arabidopsis homologues

No hit found

Paralogs
Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Potri.004G088400
[exp]
111 / 6e-32 ND /
Flax homologues

No hit found
PFAM info
Representative CDS sequence
>Potri.017G128500.2 pacid=42813762 polypeptide=Potri.017G128500.2.p locus=Potri.017G128500 ID=Potri.017G128500.2.v4.1 annot-version=v4.1
ATGAAAATATCGTCGCCCATGCATCAAATGGGTCCTCATCAACTTCTCTTCTTGCTTCTTTCCTTCTTGTTATGCACAATTATTCCGATAAGTAGAGCTA
GCGTTGCAAAAAAGCTAGACCAAACGTTAGTGCCACAAGAACCCGATGCAGGAATAAAGTGTGGATCATGCCCTTGTGTCAACCCATGTGGCCAGCTGCC
TCCTCCTCCTCCTCCTCCTCCTCCGCCCCCACCACCACCACCAACTCCATATTGTACACCTCTTGCACCACCACCACCACCACCACCACCAACTCCATAT
TGTTCACCTCTTGCACCACCACCTCCAAGGTTCTATTATGTGACCAGTACTGTGCCTGGGAGTGTGTATGAAACTGATCCTTATAATCGATGGGGGCTTT
ACGATGGTGCTAGACAGAATGCTGTCACATGGTTGCTGCTTTTGATTGGTCTTGGAGTCACAGAGCTTCTGGTGATTTGGTAA
AA sequence
>Potri.017G128500.2 pacid=42813762 polypeptide=Potri.017G128500.2.p locus=Potri.017G128500 ID=Potri.017G128500.2.v4.1 annot-version=v4.1
MKISSPMHQMGPHQLLFLLLSFLLCTIIPISRASVAKKLDQTLVPQEPDAGIKCGSCPCVNPCGQLPPPPPPPPPPPPPPPTPYCTPLAPPPPPPPPTPY
CSPLAPPPPRFYYVTSTVPGSVYETDPYNRWGLYDGARQNAVTWLLLLIGLGVTELLVIW

DESeq2's median of ratios [POPLAR]

Mapped by: Order by: Show schematic diagram

Coexpressed genes

Only top 10 genes are shown Show allDownload tab-delimited text
Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.
At best At TF class At alias At description Locus MR r Symbol NWA:WTNWB:WTNWA:OE-ARK2NWB:OE-ARK2NWA:miRNA-ARK2NWB:miRNA-ARK2NW 0hrWT H20WT-NWTUA1dEY NWTUA1dEY+TUB15 NWTUA1dY+TUB9 NWPde NWNWA:WT GANWBWT GATW:WTTW:WT GANWA:OE-ARK2 GANWB:OE-ARK2 GATW:OE-ARK2TW:OE-ARK2 GANWA:miRNA-ARK2 GANWB:miRNA-ARK2 GATW:miRNA-ARK2TW:miRNA-ARK2 GATW 2hrTW 8hrTW 24hrTW 48hrTW 96hrTW 336hrWT ACC35S::etr1-1 H2035S::etr1-1 ACCLMX5::etr1-1 H20LMX5::etr1-1 ACCWT-TWTUA1dEY TWTUA1dEY+TUB15 TWTUA1dY+TUB9 TWPde TWOW:WTOW:WT GAOW:OE-ARK2OW:OE-ARK2 GAOW:miRNA-ARK2OW:miRNA-ARK2 GAOW 2hrOW 8hrOW 24hrOW 48hrOW 96hrOW 336hrRoot CTRRoot LongColdRoot LongDrougtRoot LongHeatRoot LongSaltRoot ShortColdRoot ShortDrougtRoot ShortHeatRoot ShortSaltPtr rootLeaf CTRLeaf LongColdLeaf LongDrougtLeaf LongHeatLeaf LongSaltLeaf ShortColdLeaf ShortDrougtLeaf ShortHeatLeaf ShortSaltPtr leafStem CTRStem LongColdStem LongDrougtStem LongHeatStem LongSaltStem ShortColdStem ShortDrougtStem ShortHeatStem ShortSaltPtr shootPtr xylemPtr phloemPtr fiberPtr vesselPtr fiber vessel ray
Potri.017G128500
[exp]
0 1
AT5G19730 Pectin lyase-like superfamily ... Potri.007G015700
[exp]
2.23 0.9059
AT1G75710 C2H2ZnF C2H2-like zinc finger protein ... Potri.005G238300
[exp]
3.00 0.8691
AT3G18670 Ankyrin repeat family protein ... Potri.011G019750
[exp]
6.32 0.8806
AT4G13640 GARP UNE16 unfertilized embryo sac 16, Ho... Potri.001G314800
[exp]
12.24 0.8204
AT3G17380 TRAF-like family protein (.1) Potri.008G099600
[exp]
12.48 0.8946
Potri.001G168901
[exp]
16.73 0.8639
AT1G67050 unknown protein Potri.017G115700
[exp]
17.74 0.8472
AT2G39840 TOPP4 type one serine/threonine prot... Potri.008G166300
[exp]
18.97 0.8435
AT5G47740 Adenine nucleotide alpha hydro... Potri.012G084700
[exp]
19.33 0.8450
AT5G37660 PDLP7 plasmodesmata-located protein ... Potri.017G130800
[exp]
19.44 0.8491

Potri.017G128500 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.