Potri.017G128600 [POPLAR]


External link
JGI Phytozome v13PopgenieAspWood                  
Symbol
Arabidopsis homologues
Locus ID BLAST score/e-value TF class Alias TAIR10 short description
AT3G03341 113 / 9e-35 unknown protein
Paralogs
Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Flax homologues
Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Lus10028523 112 / 3e-34 AT3G03341 115 / 7e-36 unknown protein
Lus10009121 94 / 6e-27 AT3G03341 102 / 1e-30 unknown protein
PFAM info
Representative CDS sequence
>Potri.017G128600.1 pacid=42813001 polypeptide=Potri.017G128600.1.p locus=Potri.017G128600 ID=Potri.017G128600.1.v4.1 annot-version=v4.1
ATGACTCGTGGAGGTGGCTTTCCGATGTGTGTCCAATGCGGCACAACCAGCAACCCTTGCCGGTGCAAGGTGCTAGGTCCGACTCTTGGGTTCTTGGCGT
TTGTGGTCGCCGGGGTGGTGGAATGGCCAGTGGGGGCAGTTGTTTTTCTCTTTAAACGCATGAAGGGTCGGAGGATCATGGCCCATCCTGCCACTGTCGT
TTACCCCCGAGTCACGCATGCCATCCCTATCTAA
AA sequence
>Potri.017G128600.1 pacid=42813001 polypeptide=Potri.017G128600.1.p locus=Potri.017G128600 ID=Potri.017G128600.1.v4.1 annot-version=v4.1
MTRGGGFPMCVQCGTTSNPCRCKVLGPTLGFLAFVVAGVVEWPVGAVVFLFKRMKGRRIMAHPATVVYPRVTHAIPI

DESeq2's median of ratios [POPLAR]

Mapped by: Order by: Show schematic diagram

Coexpressed genes

Only top 10 genes are shown Show allDownload tab-delimited text
Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.
At best At TF class At alias At description Locus MR r Symbol NWA:WTNWB:WTNWA:OE-ARK2NWB:OE-ARK2NWA:miRNA-ARK2NWB:miRNA-ARK2NW 0hrWT H20WT-NWTUA1dEY NWTUA1dEY+TUB15 NWTUA1dY+TUB9 NWPde NWNWA:WT GANWBWT GATW:WTTW:WT GANWA:OE-ARK2 GANWB:OE-ARK2 GATW:OE-ARK2TW:OE-ARK2 GANWA:miRNA-ARK2 GANWB:miRNA-ARK2 GATW:miRNA-ARK2TW:miRNA-ARK2 GATW 2hrTW 8hrTW 24hrTW 48hrTW 96hrTW 336hrWT ACC35S::etr1-1 H2035S::etr1-1 ACCLMX5::etr1-1 H20LMX5::etr1-1 ACCWT-TWTUA1dEY TWTUA1dEY+TUB15 TWTUA1dY+TUB9 TWPde TWOW:WTOW:WT GAOW:OE-ARK2OW:OE-ARK2 GAOW:miRNA-ARK2OW:miRNA-ARK2 GAOW 2hrOW 8hrOW 24hrOW 48hrOW 96hrOW 336hrRoot CTRRoot LongColdRoot LongDrougtRoot LongHeatRoot LongSaltRoot ShortColdRoot ShortDrougtRoot ShortHeatRoot ShortSaltPtr rootLeaf CTRLeaf LongColdLeaf LongDrougtLeaf LongHeatLeaf LongSaltLeaf ShortColdLeaf ShortDrougtLeaf ShortHeatLeaf ShortSaltPtr leafStem CTRStem LongColdStem LongDrougtStem LongHeatStem LongSaltStem ShortColdStem ShortDrougtStem ShortHeatStem ShortSaltPtr shootPtr xylemPtr phloemPtr fiberPtr vesselPtr fiber vessel ray
AT3G03341 unknown protein Potri.017G128600 0 1
AT5G17850 Sodium/calcium exchanger famil... Potri.013G065900 1.00 0.8010
AT3G15180 ARM repeat superfamily protein... Potri.001G396500 5.29 0.7873
Potri.007G005400 8.48 0.7877
AT5G54660 HSP20-like chaperones superfam... Potri.001G416200 8.83 0.7352
AT2G01490 phytanoyl-CoA dioxygenase (Phy... Potri.006G222800 10.86 0.7023
AT3G10850 GLY2, GLX2-2 GLYOXALASE 2-2, Metallo-hydrol... Potri.019G062600 11.22 0.7487 Pt-GLX2.1
AT4G29100 bHLH bHLH068 basic helix-loop-helix (bHLH) ... Potri.001G185900 14.42 0.7994
AT5G17980 C2 calcium/lipid-binding plant... Potri.013G055500 27.56 0.7758
AT1G55340 Protein of unknown function (D... Potri.006G233100 30.59 0.7516
AT4G16790 hydroxyproline-rich glycoprote... Potri.003G079900 31.17 0.7744

Potri.017G128600 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.