Potri.017G131700 [POPLAR]


External link
JGI Phytozome v13PopgenieAspWood                  
Symbol
Arabidopsis homologues
Locus ID BLAST score/e-value TF class Alias TAIR10 short description
AT3G19940 104 / 4e-26 Major facilitator superfamily protein (.1)
AT1G50310 102 / 2e-25 ATSTP9 sugar transporter 9 (.1)
AT4G02050 99 / 4e-24 STP7 sugar transporter protein 7 (.1)
AT5G26340 98 / 8e-24 ATSTP13, MSS1, STP13 SUGAR TRANSPORT PROTEIN 13, Major facilitator superfamily protein (.1)
AT3G19930 96 / 4e-23 ATSTP4, STP4 sugar transporter 4 (.1)
AT1G77210 89 / 7e-21 AtSTP14 sugar transport protein 14, sugar transporter 14 (.1.2)
AT5G23270 87 / 5e-20 ATSTP11, STP11 sugar transporter 11 (.1)
AT3G05960 86 / 2e-19 ATSTP6 sugar transporter 6 (.1)
AT1G11260 84 / 5e-19 ATSTP1, STP1 sugar transporter 1 (.1)
AT5G26250 81 / 7e-18 Major facilitator superfamily protein (.1)
Paralogs
Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Potri.004G109765 125 / 7e-34 AT1G11260 630 / 0.0 sugar transporter 1 (.1)
Potri.004G101950 125 / 1e-33 AT1G11260 625 / 0.0 sugar transporter 1 (.1)
Potri.004G101900 125 / 1e-33 AT1G11260 625 / 0.0 sugar transporter 1 (.1)
Potri.004G110630 123 / 6e-33 AT1G11260 629 / 0.0 sugar transporter 1 (.1)
Potri.010G089800 100 / 2e-24 AT5G26340 836 / 0.0 SUGAR TRANSPORT PROTEIN 13, Major facilitator superfamily protein (.1)
Potri.006G189100 100 / 2e-24 AT4G02050 821 / 0.0 sugar transporter protein 7 (.1)
Potri.001G110400 96 / 3e-23 AT1G11260 658 / 0.0 sugar transporter 1 (.1)
Potri.018G113300 96 / 7e-23 AT4G02050 821 / 0.0 sugar transporter protein 7 (.1)
Potri.016G120700 94 / 3e-22 AT5G61520 570 / 0.0 Major facilitator superfamily protein (.1.2)
Flax homologues
Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Lus10013441 105 / 3e-26 AT1G50310 731 / 0.0 sugar transporter 9 (.1)
Lus10010534 96 / 8e-23 AT5G26340 902 / 0.0 SUGAR TRANSPORT PROTEIN 13, Major facilitator superfamily protein (.1)
Lus10002450 94 / 3e-22 AT5G26340 905 / 0.0 SUGAR TRANSPORT PROTEIN 13, Major facilitator superfamily protein (.1)
Lus10036325 91 / 3e-21 AT4G02050 801 / 0.0 sugar transporter protein 7 (.1)
Lus10040993 90 / 4e-21 AT1G50310 601 / 0.0 sugar transporter 9 (.1)
Lus10010532 88 / 3e-20 AT5G26250 588 / 0.0 Major facilitator superfamily protein (.1)
Lus10021924 87 / 5e-20 AT5G26340 832 / 0.0 SUGAR TRANSPORT PROTEIN 13, Major facilitator superfamily protein (.1)
Lus10002452 86 / 2e-19 AT5G26250 655 / 0.0 Major facilitator superfamily protein (.1)
Lus10009656 85 / 4e-19 AT5G61520 608 / 0.0 Major facilitator superfamily protein (.1.2)
Lus10020934 82 / 4e-18 AT1G34580 664 / 0.0 Major facilitator superfamily protein (.1)
PFAM info
Clan ID Clan name Pfam ID Pfam name Pfam description
CL0015 MFS PF00083 Sugar_tr Sugar (and other) transporter
Representative CDS sequence
>Potri.017G131700.3 pacid=42813214 polypeptide=Potri.017G131700.3.p locus=Potri.017G131700 ID=Potri.017G131700.3.v4.1 annot-version=v4.1
ATGAATGAACCAAGATTTTTAGCATGGAGCTGGAAATGCCAGACCAACTGCAAGGATCTTCATCTGAGGCATCCCAACAAAACGATACCTGGGCCGTCGT
ACAAAGCTTTCTTTGAATTTTCTGCTATCTGCAACCAGATTCTGCAATATGGGTGCAAAAATGAGCCTGCTAGCATCACAGGTATAGTTGTGGCATGTAT
CTGCTTCTTTGTTCCTGCTTTCTCAATGCCAAGTGAAATCCGGTCAGCCGAGCAAAGCATTGCACTCTCGGTTAACATGTTTTTCGCCTTCTCTATTGCT
CAATTGTTTCTTCCTGTGCTTTCCCCCATGAAATGTGGCTTGTTCATCTTCTTTGCGAGTTTTGTGGCAATTATGACTTCTTTATTTATTCCTTTCTTGC
CTGAAAGAAAGCACGTACCAATTGAAGAGATGTATAAAGTGTGGAAAGAACATTTGTTTTGGAGGAAATTCATGCCTGTAGATGATCACCGAGCAAATGT
CACCTCCAATGGAGAACCTTATTTCAGGCATCCAACCGGGAGGCATTTTGTGCTAAAGCTTCAGAGTATCGTTTCTCCAACTCGAAACATGTAA
AA sequence
>Potri.017G131700.3 pacid=42813214 polypeptide=Potri.017G131700.3.p locus=Potri.017G131700 ID=Potri.017G131700.3.v4.1 annot-version=v4.1
MNEPRFLAWSWKCQTNCKDLHLRHPNKTIPGPSYKAFFEFSAICNQILQYGCKNEPASITGIVVACICFFVPAFSMPSEIRSAEQSIALSVNMFFAFSIA
QLFLPVLSPMKCGLFIFFASFVAIMTSLFIPFLPERKHVPIEEMYKVWKEHLFWRKFMPVDDHRANVTSNGEPYFRHPTGRHFVLKLQSIVSPTRNM

DESeq2's median of ratios [POPLAR]

Mapped by: Order by: Show schematic diagram

Coexpressed genes

Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.
At best At TF class At alias At description Locus MR r Symbol NWA:WTNWB:WTNWA:OE-ARK2NWB:OE-ARK2NWA:miRNA-ARK2NWB:miRNA-ARK2NW 0hrWT H20WT-NWTUA1dEY NWTUA1dEY+TUB15 NWTUA1dY+TUB9 NWPde NWNWA:WT GANWBWT GATW:WTTW:WT GANWA:OE-ARK2 GANWB:OE-ARK2 GATW:OE-ARK2TW:OE-ARK2 GANWA:miRNA-ARK2 GANWB:miRNA-ARK2 GATW:miRNA-ARK2TW:miRNA-ARK2 GATW 2hrTW 8hrTW 24hrTW 48hrTW 96hrTW 336hrWT ACC35S::etr1-1 H2035S::etr1-1 ACCLMX5::etr1-1 H20LMX5::etr1-1 ACCWT-TWTUA1dEY TWTUA1dEY+TUB15 TWTUA1dY+TUB9 TWPde TWOW:WTOW:WT GAOW:OE-ARK2OW:OE-ARK2 GAOW:miRNA-ARK2OW:miRNA-ARK2 GAOW 2hrOW 8hrOW 24hrOW 48hrOW 96hrOW 336hrRoot CTRRoot LongColdRoot LongDrougtRoot LongHeatRoot LongSaltRoot ShortColdRoot ShortDrougtRoot ShortHeatRoot ShortSaltPtr rootLeaf CTRLeaf LongColdLeaf LongDrougtLeaf LongHeatLeaf LongSaltLeaf ShortColdLeaf ShortDrougtLeaf ShortHeatLeaf ShortSaltPtr leafStem CTRStem LongColdStem LongDrougtStem LongHeatStem LongSaltStem ShortColdStem ShortDrougtStem ShortHeatStem ShortSaltPtr shootPtr xylemPtr phloemPtr fiberPtr vesselPtr fiber vessel ray
AT3G19940 Major facilitator superfamily ... Potri.017G131700 0 1
AT5G43080 CYCA3;1 Cyclin A3;1 (.1) Potri.008G008476 5.65 0.7284
AT3G56850 bZIP DPBF3, AREB3 ABA-responsive element binding... Potri.008G010800 25.98 0.7191
AT1G07410 ATRAB-A2B, AtRA... ARABIDOPSIS RAB GTPASE HOMOLOG... Potri.010G197200 48.90 0.6765
AT1G13195 RING/U-box superfamily protein... Potri.010G053000 79.10 0.6398
AT4G15720 Tetratricopeptide repeat (TPR)... Potri.008G217000 108.77 0.6205
AT4G23330 unknown protein Potri.001G103800 122.80 0.6203
AT3G17810 PYD1 pyrimidine 1 (.1) Potri.012G043300 172.51 0.5489
AT5G58290 RPT3 regulatory particle triple-A A... Potri.006G028200 226.54 0.5356
AT4G35350 XCP1 xylem cysteine peptidase 1 (.1... Potri.004G207600 231.44 0.5204 Pt-XCP1.1

Potri.017G131700 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.