Potri.017G132250 [POPLAR]


External link
JGI Phytozome v13PopgenieAspWood                  
Symbol
Arabidopsis homologues
Locus ID BLAST score/e-value TF class Alias TAIR10 short description
AT1G11050 428 / 1e-147 Protein kinase superfamily protein (.1)
AT2G48010 223 / 3e-68 RKF3 receptor-like kinase in in flowers 3 (.1)
AT1G29730 171 / 5e-48 Leucine-rich repeat transmembrane protein kinase (.1)
AT1G29720 170 / 2e-47 Leucine-rich repeat transmembrane protein kinase (.1)
AT1G56120 164 / 2e-45 Leucine-rich repeat transmembrane protein kinase (.1)
AT1G56140 164 / 3e-45 Leucine-rich repeat transmembrane protein kinase (.1)
AT1G56145 161 / 2e-44 Leucine-rich repeat transmembrane protein kinase (.1.2)
AT3G53380 160 / 2e-44 Concanavalin A-like lectin protein kinase family protein (.1)
AT1G29740 160 / 6e-44 Leucine-rich repeat transmembrane protein kinase (.1)
AT5G03140 158 / 1e-43 Concanavalin A-like lectin protein kinase family protein (.1)
Paralogs
Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Potri.017G133000 495 / 2e-173 AT1G11050 830 / 0.0 Protein kinase superfamily protein (.1)
Potri.017G132800 489 / 2e-171 AT1G11050 805 / 0.0 Protein kinase superfamily protein (.1)
Potri.004G084900 460 / 6e-160 AT1G11050 821 / 0.0 Protein kinase superfamily protein (.1)
Potri.005G181800 331 / 9e-110 AT1G11050 604 / 0.0 Protein kinase superfamily protein (.1)
Potri.014G136400 234 / 5e-72 AT2G48010 794 / 0.0 receptor-like kinase in in flowers 3 (.1)
Potri.014G136466 232 / 3e-71 AT2G48010 792 / 0.0 receptor-like kinase in in flowers 3 (.1)
Potri.005G040200 209 / 8e-63 AT2G48010 613 / 0.0 receptor-like kinase in in flowers 3 (.1)
Potri.013G028000 203 / 3e-61 AT2G48010 497 / 6e-171 receptor-like kinase in in flowers 3 (.1)
Potri.011G073516 177 / 1e-51 AT1G29730 644 / 0.0 Leucine-rich repeat transmembrane protein kinase (.1)
Flax homologues
Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Lus10001295 372 / 3e-125 AT1G11050 770 / 0.0 Protein kinase superfamily protein (.1)
Lus10012701 367 / 2e-123 AT1G11050 760 / 0.0 Protein kinase superfamily protein (.1)
Lus10028549 322 / 6e-110 AT1G11050 448 / 8e-155 Protein kinase superfamily protein (.1)
Lus10018855 321 / 3e-108 AT1G11050 473 / 7e-163 Protein kinase superfamily protein (.1)
Lus10029711 300 / 1e-97 AT1G11050 549 / 0.0 Protein kinase superfamily protein (.1)
Lus10018860 269 / 2e-88 AT1G11050 384 / 6e-129 Protein kinase superfamily protein (.1)
Lus10028551 269 / 6e-86 AT1G11050 442 / 2e-148 Protein kinase superfamily protein (.1)
Lus10029714 264 / 2e-84 AT1G11050 411 / 6e-137 Protein kinase superfamily protein (.1)
Lus10028552 262 / 3e-83 AT1G11050 463 / 1e-156 Protein kinase superfamily protein (.1)
Lus10018861 258 / 9e-82 AT1G11050 465 / 4e-157 Protein kinase superfamily protein (.1)
PFAM info
Clan ID Clan name Pfam ID Pfam name Pfam description
CL0016 PKinase PF00069 Pkinase Protein kinase domain
Representative CDS sequence
>Potri.017G132250.1 pacid=42813971 polypeptide=Potri.017G132250.1.p locus=Potri.017G132250 ID=Potri.017G132250.1.v4.1 annot-version=v4.1
ATGTCAAATGGGAATCTTGATGACCATTTATTTCCATCATCGGTTAATCAAATTCAAAAGCAATTGTTAAGTTGGCCTCAAAGAAAGAGCATAATTTTGG
ATGTGGCAAGGGGATTAGCTTATTTGCACTATGGAGTCAAGCCTGGAATATATCATAGAGATATCAAGGGGACAAATATATTGTTAGATGCTGATATGAG
AGCAAGAGTTGCCGATTTTGGGTTGGCAAAGCAAAGTAGGGAAGGGCAGTCTCATCTTACTACAAGAGTGGCTGGAACTCATTGGTACTTAGCACCCGAA
TATGCTCTTTATGGTCAACTGACTGAGAAGAGCGATGTTTATAGCTTTGGGGTGGTTGTTTTGGAGATAATGTGTGGGAGAAAAGCTCTTGATTTGTCTT
CTTCAGGGTCACCTCGTGCGTTGTTGATCACAGACTGGGCCTGGTCATTGGTGAAAGCTGGAAAAGTGGAACAGGCTTTGGATGCTTCTTTGTTGAGAGG
TGGTGATTCTTCAAACTCAAATCCGAAGGGGACAATGGAAAGGTTTGTGCTGGTTGGGATTTTGTGTGCTCATATAATGGTGGCTCTAAGGCCAACCATT
CTGGATGCGCTGAAAATGTTAGAAGGAGATATTGAAGTTCCACAGATTCCAGATCGACCAGTGCCTCTTGGGCACCCTTCGTTCCAAGCTGATGGCAATA
ATTTCAGCATCTCACCAGTATTGAGTGGACCAAAATTACAGTCTGGAGACATGCTTAGAGAAAATTACAATAGATCTTCTAAGTGGCCTGAGACTACAAG
AGGTAGCCATATCAAGACTAGCCTACAAAATACTTCAAATCACCATTTTATGACAACAACATTGCTTAGTAGACCAATGCCTGACAAAATCTAA
AA sequence
>Potri.017G132250.1 pacid=42813971 polypeptide=Potri.017G132250.1.p locus=Potri.017G132250 ID=Potri.017G132250.1.v4.1 annot-version=v4.1
MSNGNLDDHLFPSSVNQIQKQLLSWPQRKSIILDVARGLAYLHYGVKPGIYHRDIKGTNILLDADMRARVADFGLAKQSREGQSHLTTRVAGTHWYLAPE
YALYGQLTEKSDVYSFGVVVLEIMCGRKALDLSSSGSPRALLITDWAWSLVKAGKVEQALDASLLRGGDSSNSNPKGTMERFVLVGILCAHIMVALRPTI
LDALKMLEGDIEVPQIPDRPVPLGHPSFQADGNNFSISPVLSGPKLQSGDMLRENYNRSSKWPETTRGSHIKTSLQNTSNHHFMTTTLLSRPMPDKI

DESeq2's median of ratios [POPLAR]

Mapped by: Order by: Show schematic diagram

Coexpressed genes

Only top 10 genes are shown Show allDownload tab-delimited text
Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.
At best At TF class At alias At description Locus MR r Symbol NWA:WTNWB:WTNWA:OE-ARK2NWB:OE-ARK2NWA:miRNA-ARK2NWB:miRNA-ARK2NW 0hrWT H20WT-NWTUA1dEY NWTUA1dEY+TUB15 NWTUA1dY+TUB9 NWPde NWNWA:WT GANWBWT GATW:WTTW:WT GANWA:OE-ARK2 GANWB:OE-ARK2 GATW:OE-ARK2TW:OE-ARK2 GANWA:miRNA-ARK2 GANWB:miRNA-ARK2 GATW:miRNA-ARK2TW:miRNA-ARK2 GATW 2hrTW 8hrTW 24hrTW 48hrTW 96hrTW 336hrWT ACC35S::etr1-1 H2035S::etr1-1 ACCLMX5::etr1-1 H20LMX5::etr1-1 ACCWT-TWTUA1dEY TWTUA1dEY+TUB15 TWTUA1dY+TUB9 TWPde TWOW:WTOW:WT GAOW:OE-ARK2OW:OE-ARK2 GAOW:miRNA-ARK2OW:miRNA-ARK2 GAOW 2hrOW 8hrOW 24hrOW 48hrOW 96hrOW 336hrRoot CTRRoot LongColdRoot LongDrougtRoot LongHeatRoot LongSaltRoot ShortColdRoot ShortDrougtRoot ShortHeatRoot ShortSaltPtr rootLeaf CTRLeaf LongColdLeaf LongDrougtLeaf LongHeatLeaf LongSaltLeaf ShortColdLeaf ShortDrougtLeaf ShortHeatLeaf ShortSaltPtr leafStem CTRStem LongColdStem LongDrougtStem LongHeatStem LongSaltStem ShortColdStem ShortDrougtStem ShortHeatStem ShortSaltPtr shootPtr xylemPtr phloemPtr fiberPtr vesselPtr fiber vessel ray
AT1G11050 Protein kinase superfamily pro... Potri.017G132250 0 1
AT3G14830 unknown protein Potri.011G106600 4.24 0.8075
AT1G33970 P-loop containing nucleoside t... Potri.013G104800 4.47 0.8155
AT3G60410 Protein of unknown function (D... Potri.002G136200 6.08 0.8389
AT3G16350 MYB Homeodomain-like superfamily p... Potri.001G189800 9.79 0.8295
AT5G25220 HD KNAT3 KNOTTED1-like homeobox gene 3 ... Potri.006G259400 13.63 0.8319
AT1G15000 SCPL50 serine carboxypeptidase-like 5... Potri.008G129850 22.97 0.7748
AT2G01060 GARP myb-like HTH transcriptional r... Potri.016G001100 23.06 0.7720
AT4G38540 FAD/NAD(P)-binding oxidoreduct... Potri.004G176950 33.01 0.8028
AT1G15000 SCPL50 serine carboxypeptidase-like 5... Potri.008G129800 36.74 0.7514
AT3G26510 Octicosapeptide/Phox/Bem1p fam... Potri.008G186500 37.30 0.7277

Potri.017G132250 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.