Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser] Popgenie AspWood
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT5G39710 42 / 3e-06 EMB2745 EMBRYO DEFECTIVE 2745, Tetratricopeptide repeat (TPR)-like superfamily protein (.1) AT1G12300 42 / 3e-06 Tetratricopeptide repeat (TPR)-like superfamily protein (.1) AT5G01110 40 / 1e-05 Tetratricopeptide repeat (TPR)-like superfamily protein (.1) AT5G14080 40 / 2e-05 Tetratricopeptide repeat (TPR)-like superfamily protein (.1) AT1G62680 40 / 2e-05 Pentatricopeptide repeat (PPR) superfamily protein (.1) AT1G71060 39 / 2e-05 Tetratricopeptide repeat (TPR)-like superfamily protein (.1) AT1G12775 39 / 3e-05 Pentatricopeptide repeat (PPR) superfamily protein (.1) AT3G16890 39 / 4e-05 PPR40 pentatricopeptide (PPR) domain protein 40 (.1) AT3G22470 39 / 4e-05 Pentatricopeptide repeat (PPR) superfamily protein (.1) AT1G62720 39 / 5e-05 AtNG1 novel gene 1, Pentatricopeptide repeat (PPR-like) superfamily protein (.1)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.005G047200 [exp] 56 / 8e-12 AT1G12620 118 / 2e-31 Pentatricopeptide repeat (PPR) superfamily protein (.1) Potri.013G034400 [exp] 57 / 1e-11 AT3G22470 476 / 1e-161 Pentatricopeptide repeat (PPR) superfamily protein (.1) Potri.005G050240 [exp] 54 / 2e-10 AT1G12700 465 / 1e-155 RNA processing factor 1, ATP binding;nucleic acid binding;helicases (.1) Potri.013G032600 [exp] 54 / 2e-10 AT1G12700 493 / 2e-166 RNA processing factor 1, ATP binding;nucleic acid binding;helicases (.1) Potri.005G046200 [exp] 53 / 4e-10 AT1G12700 501 / 5e-170 RNA processing factor 1, ATP binding;nucleic acid binding;helicases (.1) Potri.005G050500 [exp] 51 / 2e-09 AT1G12700 523 / 2e-178 RNA processing factor 1, ATP binding;nucleic acid binding;helicases (.1) Potri.005G050300 [exp] 51 / 2e-09 AT1G12700 466 / 5e-156 RNA processing factor 1, ATP binding;nucleic acid binding;helicases (.1) Potri.005G047400 [exp] 51 / 2e-09 AT1G63080 341 / 1e-110 Pentatricopeptide repeat (PPR) superfamily protein (.1) Potri.005G045000 [exp] 50 / 3e-09 AT1G12700 502 / 4e-170 RNA processing factor 1, ATP binding;nucleic acid binding;helicases (.1)
Flax homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10039310 [exp] 44 / 1e-06 AT3G22470 226 / 6e-70 Pentatricopeptide repeat (PPR) superfamily protein (.1) Lus10009201 [exp] 43 / 2e-06 AT1G12700 274 / 3e-86 RNA processing factor 1, ATP binding;nucleic acid binding;helicases (.1) Lus10014245 [exp] 42 / 2e-06 AT1G12700 427 / 5e-141 RNA processing factor 1, ATP binding;nucleic acid binding;helicases (.1) Lus10012068 [exp] 42 / 3e-06 AT5G39710 1028 / 0.0 EMBRYO DEFECTIVE 2745, Tetratricopeptide repeat (TPR)-like superfamily protein (.1) Lus10027914 [exp] 42 / 3e-06 AT5G39710 1025 / 0.0 EMBRYO DEFECTIVE 2745, Tetratricopeptide repeat (TPR)-like superfamily protein (.1) Lus10014247 [exp] 42 / 3e-06 AT1G62930 340 / 3e-109 RNA processing factor 3, Tetratricopeptide repeat (TPR)-like superfamily protein (.1) Lus10027916 [exp] 42 / 4e-06 AT5G39710 1038 / 0.0 EMBRYO DEFECTIVE 2745, Tetratricopeptide repeat (TPR)-like superfamily protein (.1) Lus10014242 [exp] 42 / 5e-06 AT1G62930 256 / 5e-78 RNA processing factor 3, Tetratricopeptide repeat (TPR)-like superfamily protein (.1) Lus10008593 [exp] 42 / 5e-06 AT1G12700 400 / 7e-131 RNA processing factor 1, ATP binding;nucleic acid binding;helicases (.1) Lus10014244 [exp] 41 / 8e-06 AT1G12700 397 / 7e-130 RNA processing factor 1, ATP binding;nucleic acid binding;helicases (.1)
PFAM info	Clan ID Clan name Pfam ID Pfam name Pfam description CL0020 [poplar] [flax] TPR PF12854 [poplar] [flax] PPR_1 PPR repeat
Representative CDS sequence Show only first row Show all	>Potri.017G133501.1 pacid=42813072 polypeptide=Potri.017G133501.1.p locus=Potri.017G133501 ID=Potri.017G133501.1.v4.1 annot-version=v4.1 ATGGGCAGCAAAGGTTACTCTTCTGGCTTTCATAGTTATAACATCTTGATCAATGGCCATTGTAAGAGTAGAAGGATCCATGAAGCAATAACTCTCTTTG CTAAAATGTGTGATAAAACATTGACTCCTGGTATTTCACTCTTACAGTGCCCATTGATTAAGATGGTATAA
AA sequence Show only first row Show all	>Potri.017G133501.1 pacid=42813072 polypeptide=Potri.017G133501.1.p locus=Potri.017G133501 ID=Potri.017G133501.1.v4.1 annot-version=v4.1 MGSKGYSSGFHSYNILINGHCKSRRIHEAITLFAKMCDKTLTPGISLLQCPLIKMV

---

DESeq2's median of ratios [POPLAR]

Mapped by: StringTie Salmon Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	NWA:WT	NWB:WT	NWA:OE-ARK2	NWB:OE-ARK2	NWA:miRNA-ARK2	NWB:miRNA-ARK2	NW 0hr	WT H20	WT-NW	TUA1dEY NW	TUA1dEY+TUB15 NW	TUA1dY+TUB9 NW	Pde NW	NWA:WT GA	NWBWT GA	TW:WT	TW:WT GA	NWA:OE-ARK2 GA	NWB:OE-ARK2 GA	TW:OE-ARK2	TW:OE-ARK2 GA	NWA:miRNA-ARK2 GA	NWB:miRNA-ARK2 GA	TW:miRNA-ARK2	TW:miRNA-ARK2 GA	TW 2hr	TW 8hr	TW 24hr	TW 48hr	TW 96hr	TW 336hr	WT ACC	35S::etr1-1 H20	35S::etr1-1 ACC	LMX5::etr1-1 H20	LMX5::etr1-1 ACC	WT-TW	TUA1dEY TW	TUA1dEY+TUB15 TW	TUA1dY+TUB9 TW	Pde TW	OW:WT	OW:WT GA	OW:OE-ARK2	OW:OE-ARK2 GA	OW:miRNA-ARK2	OW:miRNA-ARK2 GA	OW 2hr	OW 8hr	OW 24hr	OW 48hr	OW 96hr	OW 336hr	Root CTR	Root LongCold	Root LongDrougt	Root LongHeat	Root LongSalt	Root ShortCold	Root ShortDrougt	Root ShortHeat	Root ShortSalt	Ptr root	Leaf CTR	Leaf LongCold	Leaf LongDrougt	Leaf LongHeat	Leaf LongSalt	Leaf ShortCold	Leaf ShortDrougt	Leaf ShortHeat	Leaf ShortSalt	Ptr leaf	Stem CTR	Stem LongCold	Stem LongDrougt	Stem LongHeat	Stem LongSalt	Stem ShortCold	Stem ShortDrougt	Stem ShortHeat	Stem ShortSalt	Ptr shoot	Ptr xylem	Ptr phloem	Ptr fiber	Ptr vessel	Ptr fiber vessel ray
AT1G12300			Tetratricopeptide repeat (TPR)...		Potri.017G133501 [exp]	0	1
AT5G63460			SAP domain-containing protein ...		Potri.012G096900 [exp]	5.74	0.6859
AT4G27585			SPFH/Band 7/PHB domain-contain...		Potri.012G009800 [exp]	8.94	0.5968
AT2G20480			unknown protein		Potri.001G009501 [exp]	9.05	0.6881
AT3G16640		TCTP	translationally controlled tum...		Potri.008G221200 [exp]	17.88	0.6687
AT2G18110			Translation elongation factor...		Potri.009G018600 [exp]	29.18	0.6568
AT3G21820		SDG36, ATXR2	SET DOMAIN PROTEIN 36, histone...		Potri.017G038700 [exp]	29.24	0.6377	SDG943
AT1G07830			ribosomal protein L29 family p...		Potri.014G111100 [exp]	31.11	0.6232
AT2G37500			arginine biosynthesis protein ...		Potri.012G115900 [exp]	41.02	0.6057
AT2G01470		ATSEC12, STL2P	SEC12P-like 2 protein (.1)		Potri.010G111800 [exp]	41.35	0.5576
AT4G33985			Protein of unknown function (D...		Potri.005G138100 [exp]	42.00	0.6198

Compare expression of checked genes

Potri.017G133501 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.