Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser] Popgenie AspWood
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT2G03550 116 / 1e-32 alpha/beta-Hydrolases superfamily protein (.1) AT3G48690 112 / 7e-31 ATCXE12 ARABIDOPSIS THALIANA CARBOXYESTERASE 12, alpha/beta-Hydrolases superfamily protein (.1) AT3G48700 108 / 1e-29 ATCXE13 carboxyesterase 13 (.1) AT1G49660 108 / 2e-29 ATCXE5 carboxyesterase 5 (.1) AT1G19190 103 / 8e-28 alpha/beta-Hydrolases superfamily protein (.1) AT1G49650 104 / 1e-27 alpha/beta-Hydrolases superfamily protein (.1) AT1G49640 102 / 4e-27 alpha/beta-Hydrolases superfamily protein (.1) AT5G16080 94 / 4e-24 ATCXE17 carboxyesterase 17 (.1) AT1G47480 94 / 8e-24 alpha/beta-Hydrolases superfamily protein (.1) AT1G68620 89 / 5e-22 alpha/beta-Hydrolases superfamily protein (.1)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.009G105000 [exp] 186 / 5e-60 AT2G03550 234 / 1e-75 alpha/beta-Hydrolases superfamily protein (.1) Potri.004G143200 [exp] 150 / 2e-45 AT1G47480 235 / 1e-75 alpha/beta-Hydrolases superfamily protein (.1) Potri.009G104100 [exp] 132 / 2e-38 AT2G03550 330 / 6e-113 alpha/beta-Hydrolases superfamily protein (.1) Potri.004G142400 [exp] 132 / 2e-38 AT2G03550 331 / 2e-113 alpha/beta-Hydrolases superfamily protein (.1) Potri.009G104900 [exp] 132 / 2e-38 AT1G47480 320 / 1e-108 alpha/beta-Hydrolases superfamily protein (.1) Potri.009G104300 [exp] 130 / 4e-38 AT3G48700 329 / 1e-112 carboxyesterase 13 (.1) Potri.009G105100 [exp] 127 / 5e-37 AT2G03550 274 / 3e-91 alpha/beta-Hydrolases superfamily protein (.1) Potri.009G104000 [exp] 124 / 1e-35 AT2G03550 327 / 8e-112 alpha/beta-Hydrolases superfamily protein (.1) Potri.004G142900 [exp] 121 / 2e-34 AT1G19190 276 / 9e-92 alpha/beta-Hydrolases superfamily protein (.1)
Flax homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10019885 [exp] 154 / 6e-48 AT2G03550 173 / 1e-52 alpha/beta-Hydrolases superfamily protein (.1) Lus10021743 [exp] 124 / 2e-35 AT3G48700 291 / 2e-97 carboxyesterase 13 (.1) Lus10014036 [exp] 122 / 1e-34 AT3G48700 321 / 9e-110 carboxyesterase 13 (.1) Lus10014033 [exp] 123 / 2e-34 AT1G47480 246 / 3e-79 alpha/beta-Hydrolases superfamily protein (.1) Lus10027909 [exp] 121 / 2e-34 AT3G48690 311 / 2e-105 ARABIDOPSIS THALIANA CARBOXYESTERASE 12, alpha/beta-Hydrolases superfamily protein (.1) Lus10012073 [exp] 121 / 3e-34 AT3G48700 315 / 6e-107 carboxyesterase 13 (.1) Lus10019882 [exp] 119 / 9e-34 AT2G03550 308 / 1e-104 alpha/beta-Hydrolases superfamily protein (.1) Lus10014035 [exp] 120 / 1e-33 AT2G34480 338 / 2e-117 Ribosomal protein L18ae/LX family protein (.1) Lus10002907 [exp] 100 / 1e-26 AT5G16080 204 / 3e-63 carboxyesterase 17 (.1) Lus10002019 [exp] 100 / 4e-26 AT5G16080 218 / 1e-68 carboxyesterase 17 (.1)
PFAM info	Clan ID Clan name Pfam ID Pfam name Pfam description CL0028 [poplar] [flax] AB_hydrolase PF00135 [poplar] [flax] COesterase Carboxylesterase family
Representative CDS sequence Show only first row Show all	>Potri.017G133732.1 pacid=42813853 polypeptide=Potri.017G133732.1.p locus=Potri.017G133732 ID=Potri.017G133732.1.v4.1 annot-version=v4.1 ATGCTCCCTCTCCTTGTCCACTATCATGGTGGTGGCTTTTGCATAGGCTCTACATTTACTTCTGCCTTGAAGAATTTTCTTTCAACCCTAGCCACCCAAG CCAATGTCATCGCTATATCTATTGACTACAGGTTAGCAACTGAACACCAATTACTGATTGCATACGATGATTCATGGGCAGGGCTTCTGTGGATCGCGAA GCACTCTAATGGTAATGGACCCGAACCATGGATTAATGAATATGTGAATCTCGGGCGGGTTATTTTAGCCGGTGAGAGTGCTGGAGGCACCATAGCCCAT TATGTGGCAGTCCAAGCTGGGGCTGCGGGATTGGCTGTCGTGGCTATAGAAAGGTTAATAATAGCGCACCCATATTTTTAG
AA sequence Show only first row Show all	>Potri.017G133732.1 pacid=42813853 polypeptide=Potri.017G133732.1.p locus=Potri.017G133732 ID=Potri.017G133732.1.v4.1 annot-version=v4.1 MLPLLVHYHGGGFCIGSTFTSALKNFLSTLATQANVIAISIDYRLATEHQLLIAYDDSWAGLLWIAKHSNGNGPEPWINEYVNLGRVILAGESAGGTIAH YVAVQAGAAGLAVVAIERLIIAHPYF

---

DESeq2's median of ratios [POPLAR]

Mapped by: StringTie Salmon Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	NWA:WT	NWB:WT	NWA:OE-ARK2	NWB:OE-ARK2	NWA:miRNA-ARK2	NWB:miRNA-ARK2	NW 0hr	WT H20	WT-NW	TUA1dEY NW	TUA1dEY+TUB15 NW	TUA1dY+TUB9 NW	Pde NW	NWA:WT GA	NWBWT GA	TW:WT	TW:WT GA	NWA:OE-ARK2 GA	NWB:OE-ARK2 GA	TW:OE-ARK2	TW:OE-ARK2 GA	NWA:miRNA-ARK2 GA	NWB:miRNA-ARK2 GA	TW:miRNA-ARK2	TW:miRNA-ARK2 GA	TW 2hr	TW 8hr	TW 24hr	TW 48hr	TW 96hr	TW 336hr	WT ACC	35S::etr1-1 H20	35S::etr1-1 ACC	LMX5::etr1-1 H20	LMX5::etr1-1 ACC	WT-TW	TUA1dEY TW	TUA1dEY+TUB15 TW	TUA1dY+TUB9 TW	Pde TW	OW:WT	OW:WT GA	OW:OE-ARK2	OW:OE-ARK2 GA	OW:miRNA-ARK2	OW:miRNA-ARK2 GA	OW 2hr	OW 8hr	OW 24hr	OW 48hr	OW 96hr	OW 336hr	Root CTR	Root LongCold	Root LongDrougt	Root LongHeat	Root LongSalt	Root ShortCold	Root ShortDrougt	Root ShortHeat	Root ShortSalt	Ptr root	Leaf CTR	Leaf LongCold	Leaf LongDrougt	Leaf LongHeat	Leaf LongSalt	Leaf ShortCold	Leaf ShortDrougt	Leaf ShortHeat	Leaf ShortSalt	Ptr leaf	Stem CTR	Stem LongCold	Stem LongDrougt	Stem LongHeat	Stem LongSalt	Stem ShortCold	Stem ShortDrougt	Stem ShortHeat	Stem ShortSalt	Ptr shoot	Ptr xylem	Ptr phloem	Ptr fiber	Ptr vessel	Ptr fiber vessel ray
AT2G03550			alpha/beta-Hydrolases superfam...		Potri.017G133732 [exp]	0	1
AT1G72890			Disease resistance protein (TI...		Potri.006G282400 [exp]	7.74	0.9313
AT2G19070		SHT	spermidine hydroxycinnamoyl tr...		Potri.018G109900 [exp]	13.41	0.9394	HCQL5
					Potri.008G163401 [exp]	16.79	0.9117
AT5G36930			Disease resistance protein (TI...		Potri.007G143200 [exp]	16.97	0.9482
AT4G01950		ATGPAT3, GPAT3	glycerol-3-phosphate acyltrans...		Potri.002G192600 [exp]	18.43	0.9538
AT3G27170		ATCLC-B, CLC-B	chloride channel B (.1)		Potri.001G331700 [exp]	23.00	0.9425	CLC.5
AT1G78980		SRF5	STRUBBELIG-receptor family 5 (...		Potri.014G001200 [exp]	27.11	0.9536
AT3G13750		BGAL1	beta-galactosidase 1, beta gal...		Potri.003G038500 [exp]	28.33	0.9473	BGAL1.2
AT5G36930			Disease resistance protein (TI...		Potri.007G142600 [exp]	29.24	0.9440
AT4G31940		CYP82C4	"cytochrome P450, family 82, s...		Potri.004G147600 [exp]	31.96	0.9466

Compare expression of checked genes

Potri.017G133732 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.